Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WG927_RS12355 Genome accession   NZ_CP148896
Coordinates   2541397..2541570 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain XS142     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2536397..2546570
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WG927_RS12340 (WG927_12325) gcvT 2537210..2538310 (-) 1101 WP_029973877.1 glycine cleavage system aminomethyltransferase GcvT -
  WG927_RS12345 (WG927_12330) - 2538734..2540404 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  WG927_RS12350 (WG927_12335) - 2540426..2541220 (+) 795 WP_014418368.1 YqhG family protein -
  WG927_RS12355 (WG927_12340) sinI 2541397..2541570 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  WG927_RS12360 (WG927_12345) sinR 2541604..2541939 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WG927_RS12365 (WG927_12350) tasA 2541987..2542772 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  WG927_RS12370 (WG927_12355) sipW 2542837..2543421 (-) 585 WP_012117977.1 signal peptidase I SipW -
  WG927_RS12375 (WG927_12360) tapA 2543393..2544064 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  WG927_RS12380 (WG927_12365) - 2544323..2544652 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WG927_RS12385 (WG927_12370) - 2544693..2544872 (-) 180 WP_003153093.1 YqzE family protein -
  WG927_RS12390 (WG927_12375) comGG 2544929..2545306 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  WG927_RS12395 (WG927_12380) comGF 2545307..2545702 (-) 396 WP_050569584.1 competence type IV pilus minor pilin ComGF -
  WG927_RS12400 (WG927_12385) comGE 2545716..2546030 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  WG927_RS12405 (WG927_12390) comGD 2546014..2546451 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=956028 WG927_RS12355 WP_014418369.1 2541397..2541570(+) (sinI) [Bacillus velezensis strain XS142]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=956028 WG927_RS12355 WP_014418369.1 2541397..2541570(+) (sinI) [Bacillus velezensis strain XS142]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719