Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | AAA990_RS02530 | Genome accession | NZ_AP028605 |
| Coordinates | 494520..494669 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain Pne4 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 489520..499669
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAA990_RS02480 (TKY183112_04820) | blpI | 490432..490629 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| AAA990_RS02485 (TKY183112_04840) | blpJ | 491095..491364 (+) | 270 | WP_001093249.1 | bacteriocin-like peptide BlpJ | - |
| AAA990_RS02490 | cipB | 491433..491567 (+) | 135 | WP_128903586.1 | bacteriocin class II family protein | Regulator |
| AAA990_RS02495 (TKY183112_04850) | - | 491504..491662 (+) | 159 | WP_001849862.1 | hypothetical protein | - |
| AAA990_RS02500 | - | 491665..491784 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| AAA990_RS02505 (TKY183112_04860) | - | 492081..492245 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| AAA990_RS02510 (TKY183112_04870) | - | 492242..492646 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| AAA990_RS02515 | - | 492849..493653 (+) | 805 | WP_128903587.1 | IS5 family transposase | - |
| AAA990_RS02520 (TKY183112_04900) | blpM | 493803..494057 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| AAA990_RS02525 (TKY183112_04910) | blpN | 494073..494276 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| AAA990_RS02530 (TKY183112_04920) | cipB | 494520..494669 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| AAA990_RS02535 | - | 494773..494892 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| AAA990_RS02540 (TKY183112_04940) | - | 495678..496061 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| AAA990_RS02545 (TKY183112_04950) | - | 496113..496802 (+) | 690 | WP_000760529.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AAA990_RS02550 (TKY183112_04960) | blpZ | 496844..497077 (+) | 234 | WP_001849865.1 | immunity protein BlpZ | - |
| AAA990_RS02555 | - | 497228..497839 (+) | 612 | WP_000394037.1 | type II CAAX endopeptidase family protein | - |
| AAA990_RS02560 (TKY183112_04970) | - | 498000..498794 (+) | 795 | WP_000363010.1 | phosphotransferase family protein | - |
| AAA990_RS02565 (TKY183112_04980) | trmB | 498791..499426 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=95462 AAA990_RS02530 WP_001818346.1 494520..494669(+) (cipB) [Streptococcus pneumoniae strain Pne4]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=95462 AAA990_RS02530 WP_001818346.1 494520..494669(+) (cipB) [Streptococcus pneumoniae strain Pne4]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |