Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   AAA990_RS02490 Genome accession   NZ_AP028605
Coordinates   491433..491567 (+) Length   44 a.a.
NCBI ID   WP_128903586.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain Pne4     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 486433..496567
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAA990_RS02470 (TKY183112_04800) - 486626..487987 (-) 1362 WP_001069067.1 bacteriocin secretion accessory protein -
  AAA990_RS02475 (TKY183112_04810) comA/nlmT 487998..490151 (-) 2154 WP_000205168.1 peptide cleavage/export ABC transporter BlpA Regulator
  AAA990_RS02480 (TKY183112_04820) blpI 490432..490629 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  AAA990_RS02485 (TKY183112_04840) blpJ 491095..491364 (+) 270 WP_001093249.1 bacteriocin-like peptide BlpJ -
  AAA990_RS02490 cipB 491433..491567 (+) 135 WP_128903586.1 bacteriocin class II family protein Regulator
  AAA990_RS02495 (TKY183112_04850) - 491504..491662 (+) 159 WP_001849862.1 hypothetical protein -
  AAA990_RS02500 - 491665..491784 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  AAA990_RS02505 (TKY183112_04860) - 492081..492245 (+) 165 WP_000727118.1 hypothetical protein -
  AAA990_RS02510 (TKY183112_04870) - 492242..492646 (+) 405 WP_000846943.1 hypothetical protein -
  AAA990_RS02515 - 492849..493653 (+) 805 WP_128903587.1 IS5 family transposase -
  AAA990_RS02520 (TKY183112_04900) blpM 493803..494057 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AAA990_RS02525 (TKY183112_04910) blpN 494073..494276 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AAA990_RS02530 (TKY183112_04920) cipB 494520..494669 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  AAA990_RS02535 - 494773..494892 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  AAA990_RS02540 (TKY183112_04940) - 495678..496061 (+) 384 WP_000877381.1 hypothetical protein -

Sequence

Protein


Download         Length: 44 a.a.        Molecular weight: 5055.79 Da        Isoelectric Point: 3.6910

>NTDB_id=95461 AAA990_RS02490 WP_128903586.1 491433..491567(+) (cipB) [Streptococcus pneumoniae strain Pne4]
MDTKMMSQFSVMDTEMLACVEGGGCNWEILPKQVLEEQQQEVFN

Nucleotide


Download         Length: 135 bp        

>NTDB_id=95461 AAA990_RS02490 WP_128903586.1 491433..491567(+) (cipB) [Streptococcus pneumoniae strain Pne4]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATACTGAAATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGAGATTTTGCCAAAGCAGGTGTTGGAGGAGCAGCAGCAAGAGGTCTTCAACTAG

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-27)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

43.59

88.636

0.386

Multiple sequence alignment