Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | QMM10_RS02500 | Genome accession | NZ_AP025938 |
| Coordinates | 487775..487924 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PZ900701057 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 482775..492924
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMM10_RS02475 (PC1044_04770) | blpC | 483035..483190 (-) | 156 | WP_044791640.1 | quorum-sensing system pheromone BlpC | - |
| QMM10_RS02480 | - | 483247..484608 (-) | 1362 | Protein_490 | bacteriocin secretion accessory protein | - |
| QMM10_RS02485 (PC1044_04800) | comA/nlmT | 484619..486295 (-) | 1677 | WP_318155894.1 | peptide cleavage/export ABC transporter | Regulator |
| QMM10_RS10585 (PC1044_04810) | comA/nlmT | 486189..486776 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| QMM10_RS02490 (PC1044_04820) | blpM | 487058..487312 (+) | 255 | WP_001093256.1 | two-peptide bacteriocin subunit BlpM | - |
| QMM10_RS02495 (PC1044_04830) | blpN | 487328..487531 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| QMM10_RS02500 (PC1044_04840) | cipB | 487775..487924 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| QMM10_RS02505 | - | 488028..488147 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| QMM10_RS02510 (PC1044_04850) | - | 488445..488609 (+) | 165 | WP_000727117.1 | hypothetical protein | - |
| QMM10_RS02515 (PC1044_04860) | - | 488671..489009 (+) | 339 | WP_088804618.1 | immunity protein | - |
| QMM10_RS02520 (PC1044_04880) | - | 489638..490021 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| QMM10_RS02525 (PC1044_04890) | - | 490073..490762 (+) | 690 | WP_000760520.1 | CPBP family intramembrane glutamic endopeptidase | - |
| QMM10_RS02530 (PC1044_04900) | blpZ | 490804..491052 (+) | 249 | WP_000276501.1 | immunity protein BlpZ | - |
| QMM10_RS02535 | - | 491082..491693 (+) | 612 | WP_000394036.1 | type II CAAX endopeptidase family protein | - |
| QMM10_RS02540 (PC1044_04910) | - | 491854..492648 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=95341 QMM10_RS02500 WP_001809846.1 487775..487924(+) (cipB) [Streptococcus pneumoniae strain PZ900701057]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=95341 QMM10_RS02500 WP_001809846.1 487775..487924(+) (cipB) [Streptococcus pneumoniae strain PZ900701057]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |