Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | AAA980_RS02950 | Genome accession | NZ_AP028604 |
| Coordinates | 548131..548280 (+) | Length | 49 a.a. |
| NCBI ID | WP_001813641.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain Pne3 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 543131..553280
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAA980_RS02915 (TKY182805_05720) | blpU | 545047..545277 (+) | 231 | WP_001093268.1 | bacteriocin-like peptide BlpU | - |
| AAA980_RS02920 | - | 545280..545399 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| AAA980_RS02925 (TKY182805_05730) | - | 545696..545860 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| AAA980_RS02930 (TKY182805_05740) | - | 545857..546261 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| AAA980_RS02935 | - | 546459..547264 (+) | 806 | Protein_578 | IS5 family transposase | - |
| AAA980_RS02940 (TKY182805_05770) | blpM | 547414..547668 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| AAA980_RS02945 (TKY182805_05780) | blpN | 547684..547887 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| AAA980_RS02950 (TKY182805_05790) | cipB | 548131..548280 (+) | 150 | WP_001813641.1 | bacteriocin-like peptide BlpO | Regulator |
| AAA980_RS02955 | - | 548384..548503 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| AAA980_RS02960 (TKY182805_05810) | - | 549289..549672 (+) | 384 | WP_000877378.1 | hypothetical protein | - |
| AAA980_RS02965 (TKY182805_05820) | - | 549724..550413 (+) | 690 | WP_000760541.1 | CPBP family intramembrane glutamic endopeptidase | - |
| AAA980_RS02970 (TKY182805_05830) | blpZ | 550455..550688 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| AAA980_RS02975 | - | 550839..551450 (+) | 612 | WP_000394045.1 | type II CAAX endopeptidase family protein | - |
| AAA980_RS02980 (TKY182805_05840) | - | 551611..552405 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
| AAA980_RS02985 (TKY182805_05850) | trmB | 552402..553037 (+) | 636 | WP_001266078.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5164.93 Da Isoelectric Point: 3.9133
>NTDB_id=95340 AAA980_RS02950 WP_001813641.1 548131..548280(+) (cipB) [Streptococcus pneumoniae strain Pne3]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=95340 AAA980_RS02950 WP_001813641.1 548131..548280(+) (cipB) [Streptococcus pneumoniae strain Pne3]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
48.98 |
100 |
0.49 |