Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   AAA980_RS00670 Genome accession   NZ_AP028604
Coordinates   108857..109015 (+) Length   52 a.a.
NCBI ID   WP_001093073.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain Pne3     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 103857..114015
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAA980_RS00640 (TKY182805_01250) - 103995..105005 (-) 1011 WP_000009171.1 YeiH family protein -
  AAA980_RS00645 (TKY182805_01260) - 105154..106323 (+) 1170 WP_000366342.1 pyridoxal phosphate-dependent aminotransferase -
  AAA980_RS00650 (TKY182805_01270) recO 106320..107090 (+) 771 WP_000616164.1 DNA repair protein RecO Machinery gene
  AAA980_RS00655 (TKY182805_01280) plsX 107087..108079 (+) 993 WP_000717467.1 phosphate acyltransferase PlsX -
  AAA980_RS00660 (TKY182805_01290) - 108085..108318 (+) 234 WP_000136447.1 acyl carrier protein -
  AAA980_RS00665 (TKY182805_01300) - 108364..108654 (+) 291 Protein_125 IS5/IS1182 family transposase -
  AAA980_RS00670 (TKY182805_01310) cipB 108857..109015 (+) 159 WP_001093073.1 bacteriocin class II family protein Regulator
  AAA980_RS00675 - 109018..109143 (+) 126 WP_000346297.1 PncF family bacteriocin immunity protein -
  AAA980_RS00680 (TKY182805_01320) comA 109734..111887 (+) 2154 WP_000668282.1 peptide cleavage/export ABC transporter ComA Regulator
  AAA980_RS00685 (TKY182805_01330) comB 111900..113249 (+) 1350 WP_000801620.1 competence pheromone export protein ComB Regulator

Sequence

Protein


Download         Length: 52 a.a.        Molecular weight: 5435.25 Da        Isoelectric Point: 4.2644

>NTDB_id=95321 AAA980_RS00670 WP_001093073.1 108857..109015(+) (cipB) [Streptococcus pneumoniae strain Pne3]
MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAILGGVAYAATCWW

Nucleotide


Download         Length: 159 bp        

>NTDB_id=95321 AAA980_RS00670 WP_001093073.1 108857..109015(+) (cipB) [Streptococcus pneumoniae strain Pne3]
ATGAATACAAAAAAGATGTCACAATTTGAAATTATGGATACTGAGATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGGAGATTTTGCCAAAGCAGGTGTTGGAGGAGGAGCTATACTTGGAGGTGTGGCCTATGCAGCGACATGTTGGTGGTAA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-51)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

44

96.154

0.423

Multiple sequence alignment