NTDB

Overview

Name	Cj0011c	Type	Machinery gene
Locus tag	WHP40_RS02070	Genome accession	NZ_CP148223
Coordinates	390113..390352 (+)	Length	79 a.a.
NCBI ID	WP_002853093.1	Uniprot ID	A0AB36GBA9
Organism	Campylobacter jejuni strain Z1323CCJ0045
Function	DNA binding (predicted from homology) DNA binding and uptake

Genomic Context

Location: 385113..395352

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
WHP40_RS02050 (WHP40_02050)	-	385711..386937 (+)	1227	WP_002853125.1	HD domain-containing protein	-
WHP40_RS02055 (WHP40_02055)	-	387029..387553 (+)	525	WP_002853079.1	YagU family protein	-
WHP40_RS02060 (WHP40_02060)	ilvD	387565..389241 (-)	1677	WP_002853088.1	dihydroxy-acid dehydratase	-
WHP40_RS02065 (WHP40_02065)	rrc	389401..390048 (+)	648	WP_002853081.1	ferritin family protein	-
WHP40_RS02070 (WHP40_02070)	Cj0011c	390113..390352 (+)	240	WP_002853093.1	ComEA family DNA-binding protein	Machinery gene
WHP40_RS02075 (WHP40_02075)	rnhB	390385..390960 (+)	576	WP_002853153.1	ribonuclease HII	-
WHP40_RS02080 (WHP40_02080)	gltD	390961..392406 (-)	1446	WP_228567963.1	glutamate synthase subunit beta	-
WHP40_RS02085 (WHP40_02085)	-	392409..394160 (-)	1752	WP_002853121.1	DUF262 domain-containing protein	-

Sequence

Protein

Download Length: 79 a.a. Molecular weight: 8852.50 Da Isoelectric Point: 10.1677

                                >NTDB_id=952983 WHP40_RS02070 WP_002853093.1 390113..390352(+) (Cj0011c) [Campylobacter jejuni strain Z1323CCJ0045]

MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILEYRKEANFTSIDDLKKVKGIGDKLFEKIKNDITIE

Nucleotide

Download Length: 240 bp

                                >NTDB_id=952983 WHP40_RS02070 WP_002853093.1 390113..390352(+) (Cj0011c) [Campylobacter jejuni strain Z1323CCJ0045]

ATGAAAAAATTACTATTTTTATTTTTTGCTTTAACGGCTTTTCTCTTTGGTGCTGTAAATATCAACACTGCAACACTAAA

AGAATTAAAAAGTTTAAATGGTATTGGCGAAGCTAAAGCTAAAGCGATTTTAGAATACCGCAAAGAAGCAAATTTTACAA

GTATTGATGATCTTAAAAAAGTTAAAGGCATAGGTGATAAGCTTTTTGAAAAAATCAAAAATGATATCACAATAGAATAA

Domains

Predicted by InterproScan.

Helix-hairpin-helix motif (HHH_3)

(18-77)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
Cj0011c	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	100	100	1
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comE	Neisseria gonorrhoeae MS11	51.852	100	0.532
comEA	Staphylococcus aureus N315	57.377	77.215	0.443
comEA	Bacillus subtilis subsp. subtilis str. 168	57.377	77.215	0.443
comEA	Staphylococcus aureus MW2	57.377	77.215	0.443
comEA	Acinetobacter baylyi ADP1	57.377	77.215	0.443
comEA	Lactococcus lactis subsp. cremoris KW2	53.226	78.481	0.418
comEA	Vibrio cholerae strain A1552	62.745	64.557	0.405
comEA	Vibrio cholerae C6706	62.745	64.557	0.405
comEA/comE1	Glaesserella parasuis strain SC1401	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus pneumoniae Rx1	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus pneumoniae D39	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus pneumoniae R6	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus pneumoniae TIGR4	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus mitis NCTC 12261	49.206	79.747	0.392
comEA/celA/cilE	Streptococcus mitis SK321	47.619	79.747	0.38
comEA	Acinetobacter baumannii D1279779	47.619	79.747	0.38
comE1/comEA	Haemophilus influenzae Rd KW20	50.847	74.684	0.38
comEA	Acinetobacter baumannii strain A118	46.032	79.747	0.367
comEA	Vibrio campbellii strain DS40M4	48.333	75.949	0.367

Detailed information NTG0952983