Detailed information
Bioinformatically predicted
Overview
| Name | CJE1441 | Type | Regulator |
| Locus tag | WHP67_RS07755 | Genome accession | NZ_CP148195 |
| Coordinates | 1467321..1467974 (-) | Length | 217 a.a. |
| NCBI ID | WP_019109051.1 | Uniprot ID | - |
| Organism | Campylobacter jejuni strain Z1323CCJ0074 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1443014..1483441 | 1467321..1467974 | within | 0 |
Gene organization within MGE regions
Location: 1443014..1483441
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WHP67_RS07605 (WHP67_07605) | - | 1443014..1443304 (+) | 291 | WP_002788257.1 | hypothetical protein | - |
| WHP67_RS07610 (WHP67_07610) | - | 1443291..1443632 (+) | 342 | WP_002788260.1 | HNH endonuclease signature motif containing protein | - |
| WHP67_RS07615 (WHP67_07615) | - | 1443892..1444527 (+) | 636 | WP_002788261.1 | P27 family phage terminase small subunit | - |
| WHP67_RS07620 (WHP67_07620) | - | 1444531..1446156 (+) | 1626 | WP_002788263.1 | terminase TerL endonuclease subunit | - |
| WHP67_RS07625 (WHP67_07625) | - | 1446211..1446645 (+) | 435 | WP_002788265.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| WHP67_RS07630 (WHP67_07630) | - | 1446805..1447977 (+) | 1173 | WP_002788272.1 | phage portal protein | - |
| WHP67_RS07635 (WHP67_07635) | - | 1447974..1448516 (+) | 543 | WP_002864096.1 | HK97 gp10 family phage protein | - |
| WHP67_RS07640 (WHP67_07640) | - | 1448517..1448867 (+) | 351 | WP_002788276.1 | hypothetical protein | - |
| WHP67_RS07645 (WHP67_07645) | - | 1449039..1450019 (+) | 981 | WP_002858135.1 | hypothetical protein | - |
| WHP67_RS07650 (WHP67_07650) | - | 1450016..1450372 (+) | 357 | WP_002788281.1 | hypothetical protein | - |
| WHP67_RS07655 (WHP67_07655) | - | 1450453..1450668 (+) | 216 | WP_002788282.1 | hypothetical protein | - |
| WHP67_RS07660 (WHP67_07660) | - | 1450660..1450998 (-) | 339 | WP_002788283.1 | hypothetical protein | - |
| WHP67_RS07665 (WHP67_07665) | - | 1451058..1456784 (+) | 5727 | WP_002800774.1 | hypothetical protein | - |
| WHP67_RS07670 (WHP67_07670) | - | 1456797..1457666 (+) | 870 | WP_002788286.1 | hypothetical protein | - |
| WHP67_RS07675 (WHP67_07675) | - | 1457752..1458309 (+) | 558 | WP_002788287.1 | HK97 family phage prohead protease | - |
| WHP67_RS07680 (WHP67_07680) | - | 1458326..1459492 (+) | 1167 | WP_338905176.1 | phage major capsid protein | - |
| WHP67_RS07685 (WHP67_07685) | - | 1459503..1459754 (+) | 252 | WP_002788291.1 | hypothetical protein | - |
| WHP67_RS07690 (WHP67_07690) | - | 1459751..1460188 (+) | 438 | WP_002788293.1 | phage gp6-like head-tail connector protein | - |
| WHP67_RS07695 (WHP67_07695) | - | 1460201..1460518 (+) | 318 | WP_002788295.1 | head-tail adaptor protein | - |
| WHP67_RS07700 (WHP67_07700) | - | 1460515..1461147 (+) | 633 | WP_002788297.1 | hypothetical protein | - |
| WHP67_RS07705 (WHP67_07705) | - | 1461140..1462705 (+) | 1566 | WP_002858267.1 | hypothetical protein | - |
| WHP67_RS07710 (WHP67_07710) | - | 1462707..1463156 (+) | 450 | WP_070313924.1 | hypothetical protein | - |
| WHP67_RS07715 (WHP67_07715) | - | 1463169..1463804 (+) | 636 | WP_070310085.1 | DUF4376 domain-containing protein | - |
| WHP67_RS07720 (WHP67_07720) | - | 1463801..1464265 (+) | 465 | WP_002801917.1 | hypothetical protein | - |
| WHP67_RS07725 (WHP67_07725) | - | 1464255..1464626 (+) | 372 | WP_002801918.1 | DUF1353 domain-containing protein | - |
| WHP67_RS07730 (WHP67_07730) | - | 1464623..1465906 (+) | 1284 | WP_002801920.1 | hypothetical protein | - |
| WHP67_RS07735 (WHP67_07735) | - | 1465955..1466413 (+) | 459 | WP_002858146.1 | DUF5675 family protein | - |
| WHP67_RS07740 (WHP67_07740) | - | 1466475..1466894 (+) | 420 | WP_002857883.1 | hypothetical protein | - |
| WHP67_RS07745 (WHP67_07745) | - | 1466812..1467009 (+) | 198 | WP_002870262.1 | hypothetical protein | - |
| WHP67_RS07750 (WHP67_07750) | - | 1467023..1467304 (-) | 282 | WP_002870263.1 | PLDc N-terminal domain-containing protein | - |
| WHP67_RS07755 (WHP67_07755) | CJE1441 | 1467321..1467974 (-) | 654 | WP_019109051.1 | DNA/RNA non-specific endonuclease | Regulator |
| WHP67_RS07760 (WHP67_07760) | - | 1467980..1468801 (-) | 822 | WP_052774273.1 | hypothetical protein | - |
| WHP67_RS07765 (WHP67_07765) | - | 1468791..1469030 (-) | 240 | WP_019108957.1 | hypothetical protein | - |
| WHP67_RS07770 (WHP67_07770) | - | 1469227..1469889 (-) | 663 | WP_019108958.1 | S24/S26 family peptidase | - |
| WHP67_RS07775 (WHP67_07775) | - | 1470124..1470777 (-) | 654 | WP_019108959.1 | hypothetical protein | - |
| WHP67_RS07780 (WHP67_07780) | - | 1470981..1471184 (+) | 204 | WP_002858450.1 | hypothetical protein | - |
| WHP67_RS07785 (WHP67_07785) | - | 1471181..1471465 (+) | 285 | WP_002788580.1 | hypothetical protein | - |
| WHP67_RS07790 (WHP67_07790) | - | 1471896..1472627 (+) | 732 | WP_002801548.1 | phage regulatory protein/antirepressor Ant | - |
| WHP67_RS07795 (WHP67_07795) | - | 1472680..1472967 (+) | 288 | WP_338905188.1 | YopX family protein | - |
| WHP67_RS07800 (WHP67_07800) | - | 1473024..1473287 (+) | 264 | WP_002787281.1 | hypothetical protein | - |
| WHP67_RS07805 (WHP67_07805) | - | 1473253..1473483 (+) | 231 | WP_002787283.1 | hypothetical protein | - |
| WHP67_RS07810 (WHP67_07810) | - | 1473621..1474388 (+) | 768 | WP_002787287.1 | hypothetical protein | - |
| WHP67_RS07815 (WHP67_07815) | - | 1474402..1474638 (+) | 237 | WP_002787289.1 | hypothetical protein | - |
| WHP67_RS07820 (WHP67_07820) | - | 1475026..1475346 (+) | 321 | WP_002787293.1 | hypothetical protein | - |
| WHP67_RS07825 (WHP67_07825) | - | 1475425..1475739 (+) | 315 | WP_002787295.1 | hypothetical protein | - |
| WHP67_RS07830 (WHP67_07830) | - | 1475676..1476437 (+) | 762 | WP_002787298.1 | hypothetical protein | - |
| WHP67_RS07835 (WHP67_07835) | - | 1476446..1476670 (+) | 225 | WP_002787300.1 | hypothetical protein | - |
| WHP67_RS07840 (WHP67_07840) | - | 1476671..1477042 (+) | 372 | WP_002858334.1 | hypothetical protein | - |
| WHP67_RS07845 (WHP67_07845) | - | 1477026..1477292 (+) | 267 | WP_002787304.1 | hypothetical protein | - |
| WHP67_RS07850 (WHP67_07850) | - | 1477270..1478025 (+) | 756 | WP_002787306.1 | site-specific DNA-methyltransferase | - |
| WHP67_RS07855 (WHP67_07855) | - | 1478043..1478396 (+) | 354 | WP_002787307.1 | hypothetical protein | - |
| WHP67_RS07860 (WHP67_07860) | - | 1478398..1478604 (+) | 207 | WP_002787309.1 | helix-turn-helix domain-containing protein | - |
| WHP67_RS07865 (WHP67_07865) | - | 1478601..1479776 (-) | 1176 | WP_002787311.1 | site-specific integrase | - |
| WHP67_RS07875 (WHP67_07875) | mrdB | 1480115..1481215 (-) | 1101 | WP_002864601.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| WHP67_RS07880 (WHP67_07880) | - | 1481293..1482261 (+) | 969 | WP_002858282.1 | RluA family pseudouridine synthase | - |
| WHP67_RS07885 (WHP67_07885) | - | 1482206..1483441 (+) | 1236 | WP_010891920.1 | fibronectin type III domain-containing protein | - |
Sequence
Protein
Download Length: 217 a.a. Molecular weight: 25719.25 Da Isoelectric Point: 9.7797
>NTDB_id=952562 WHP67_RS07755 WP_019109051.1 1467321..1467974(-) (CJE1441) [Campylobacter jejuni strain Z1323CCJ0074]
MKKLTILFLLATLAFADYTQYKPSEEFAKYFTKQNCSQVLDKFYYLNCYDYDYKGTKAVAYRLEAENLRGKQIKKRPRFE
DDTNIPKKYRTTWSDYKHSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRIWNKIEKRERQLALKLGSLEVL
NLINYDNNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF
MKKLTILFLLATLAFADYTQYKPSEEFAKYFTKQNCSQVLDKFYYLNCYDYDYKGTKAVAYRLEAENLRGKQIKKRPRFE
DDTNIPKKYRTTWSDYKHSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRIWNKIEKRERQLALKLGSLEVL
NLINYDNNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF
Nucleotide
Download Length: 654 bp
>NTDB_id=952562 WHP67_RS07755 WP_019109051.1 1467321..1467974(-) (CJE1441) [Campylobacter jejuni strain Z1323CCJ0074]
ATGAAAAAACTTACAATCTTATTCTTACTAGCAACTCTAGCTTTTGCTGATTATACACAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAACAAAATTGCTCACAAGTTTTAGACAAATTCTATTATCTAAATTGTTACGATTATGATTATA
AAGGGACAAAAGCAGTAGCTTATAGATTAGAAGCAGAAAATCTAAGAGGCAAACAAATTAAAAAGCGTCCTCGTTTTGAA
GATGATACCAATATTCCTAAAAAATACCGCACCACTTGGAGCGATTATAAGCATAGCGGTTATGATAGAGGGCATACTCT
TTCTAATGCCTCTATGAGAAAAACCACTCAAGCACAAAGAAGCACTTTTTTAATGAGCAATATCACTCCACAAAATCCAC
AAATTAACCAAAGGATTTGGAATAAGATTGAAAAACGCGAAAGACAACTAGCTTTAAAACTCGGAAGTTTAGAAGTTTTA
AATTTAATCAATTATGATAATAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA
ATGAAAAAACTTACAATCTTATTCTTACTAGCAACTCTAGCTTTTGCTGATTATACACAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAACAAAATTGCTCACAAGTTTTAGACAAATTCTATTATCTAAATTGTTACGATTATGATTATA
AAGGGACAAAAGCAGTAGCTTATAGATTAGAAGCAGAAAATCTAAGAGGCAAACAAATTAAAAAGCGTCCTCGTTTTGAA
GATGATACCAATATTCCTAAAAAATACCGCACCACTTGGAGCGATTATAAGCATAGCGGTTATGATAGAGGGCATACTCT
TTCTAATGCCTCTATGAGAAAAACCACTCAAGCACAAAGAAGCACTTTTTTAATGAGCAATATCACTCCACAAAATCCAC
AAATTAACCAAAGGATTTGGAATAAGATTGAAAAACGCGAAAGACAACTAGCTTTAAAACTCGGAAGTTTAGAAGTTTTA
AATTTAATCAATTATGATAATAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| CJE1441 | Campylobacter jejuni RM1221 |
89.862 |
100 |
0.899 |
| CJE0566 | Campylobacter jejuni RM1221 |
87.442 |
99.078 |
0.866 |