Detailed information    

insolico Bioinformatically predicted

Overview


Name   CJE1441   Type   Regulator
Locus tag   WHP67_RS07755 Genome accession   NZ_CP148195
Coordinates   1467321..1467974 (-) Length   217 a.a.
NCBI ID   WP_019109051.1    Uniprot ID   -
Organism   Campylobacter jejuni strain Z1323CCJ0074     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1443014..1483441 1467321..1467974 within 0


Gene organization within MGE regions


Location: 1443014..1483441
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHP67_RS07605 (WHP67_07605) - 1443014..1443304 (+) 291 WP_002788257.1 hypothetical protein -
  WHP67_RS07610 (WHP67_07610) - 1443291..1443632 (+) 342 WP_002788260.1 HNH endonuclease signature motif containing protein -
  WHP67_RS07615 (WHP67_07615) - 1443892..1444527 (+) 636 WP_002788261.1 P27 family phage terminase small subunit -
  WHP67_RS07620 (WHP67_07620) - 1444531..1446156 (+) 1626 WP_002788263.1 terminase TerL endonuclease subunit -
  WHP67_RS07625 (WHP67_07625) - 1446211..1446645 (+) 435 WP_002788265.1 type II toxin-antitoxin system PemK/MazF family toxin -
  WHP67_RS07630 (WHP67_07630) - 1446805..1447977 (+) 1173 WP_002788272.1 phage portal protein -
  WHP67_RS07635 (WHP67_07635) - 1447974..1448516 (+) 543 WP_002864096.1 HK97 gp10 family phage protein -
  WHP67_RS07640 (WHP67_07640) - 1448517..1448867 (+) 351 WP_002788276.1 hypothetical protein -
  WHP67_RS07645 (WHP67_07645) - 1449039..1450019 (+) 981 WP_002858135.1 hypothetical protein -
  WHP67_RS07650 (WHP67_07650) - 1450016..1450372 (+) 357 WP_002788281.1 hypothetical protein -
  WHP67_RS07655 (WHP67_07655) - 1450453..1450668 (+) 216 WP_002788282.1 hypothetical protein -
  WHP67_RS07660 (WHP67_07660) - 1450660..1450998 (-) 339 WP_002788283.1 hypothetical protein -
  WHP67_RS07665 (WHP67_07665) - 1451058..1456784 (+) 5727 WP_002800774.1 hypothetical protein -
  WHP67_RS07670 (WHP67_07670) - 1456797..1457666 (+) 870 WP_002788286.1 hypothetical protein -
  WHP67_RS07675 (WHP67_07675) - 1457752..1458309 (+) 558 WP_002788287.1 HK97 family phage prohead protease -
  WHP67_RS07680 (WHP67_07680) - 1458326..1459492 (+) 1167 WP_338905176.1 phage major capsid protein -
  WHP67_RS07685 (WHP67_07685) - 1459503..1459754 (+) 252 WP_002788291.1 hypothetical protein -
  WHP67_RS07690 (WHP67_07690) - 1459751..1460188 (+) 438 WP_002788293.1 phage gp6-like head-tail connector protein -
  WHP67_RS07695 (WHP67_07695) - 1460201..1460518 (+) 318 WP_002788295.1 head-tail adaptor protein -
  WHP67_RS07700 (WHP67_07700) - 1460515..1461147 (+) 633 WP_002788297.1 hypothetical protein -
  WHP67_RS07705 (WHP67_07705) - 1461140..1462705 (+) 1566 WP_002858267.1 hypothetical protein -
  WHP67_RS07710 (WHP67_07710) - 1462707..1463156 (+) 450 WP_070313924.1 hypothetical protein -
  WHP67_RS07715 (WHP67_07715) - 1463169..1463804 (+) 636 WP_070310085.1 DUF4376 domain-containing protein -
  WHP67_RS07720 (WHP67_07720) - 1463801..1464265 (+) 465 WP_002801917.1 hypothetical protein -
  WHP67_RS07725 (WHP67_07725) - 1464255..1464626 (+) 372 WP_002801918.1 DUF1353 domain-containing protein -
  WHP67_RS07730 (WHP67_07730) - 1464623..1465906 (+) 1284 WP_002801920.1 hypothetical protein -
  WHP67_RS07735 (WHP67_07735) - 1465955..1466413 (+) 459 WP_002858146.1 DUF5675 family protein -
  WHP67_RS07740 (WHP67_07740) - 1466475..1466894 (+) 420 WP_002857883.1 hypothetical protein -
  WHP67_RS07745 (WHP67_07745) - 1466812..1467009 (+) 198 WP_002870262.1 hypothetical protein -
  WHP67_RS07750 (WHP67_07750) - 1467023..1467304 (-) 282 WP_002870263.1 PLDc N-terminal domain-containing protein -
  WHP67_RS07755 (WHP67_07755) CJE1441 1467321..1467974 (-) 654 WP_019109051.1 DNA/RNA non-specific endonuclease Regulator
  WHP67_RS07760 (WHP67_07760) - 1467980..1468801 (-) 822 WP_052774273.1 hypothetical protein -
  WHP67_RS07765 (WHP67_07765) - 1468791..1469030 (-) 240 WP_019108957.1 hypothetical protein -
  WHP67_RS07770 (WHP67_07770) - 1469227..1469889 (-) 663 WP_019108958.1 S24/S26 family peptidase -
  WHP67_RS07775 (WHP67_07775) - 1470124..1470777 (-) 654 WP_019108959.1 hypothetical protein -
  WHP67_RS07780 (WHP67_07780) - 1470981..1471184 (+) 204 WP_002858450.1 hypothetical protein -
  WHP67_RS07785 (WHP67_07785) - 1471181..1471465 (+) 285 WP_002788580.1 hypothetical protein -
  WHP67_RS07790 (WHP67_07790) - 1471896..1472627 (+) 732 WP_002801548.1 phage regulatory protein/antirepressor Ant -
  WHP67_RS07795 (WHP67_07795) - 1472680..1472967 (+) 288 WP_338905188.1 YopX family protein -
  WHP67_RS07800 (WHP67_07800) - 1473024..1473287 (+) 264 WP_002787281.1 hypothetical protein -
  WHP67_RS07805 (WHP67_07805) - 1473253..1473483 (+) 231 WP_002787283.1 hypothetical protein -
  WHP67_RS07810 (WHP67_07810) - 1473621..1474388 (+) 768 WP_002787287.1 hypothetical protein -
  WHP67_RS07815 (WHP67_07815) - 1474402..1474638 (+) 237 WP_002787289.1 hypothetical protein -
  WHP67_RS07820 (WHP67_07820) - 1475026..1475346 (+) 321 WP_002787293.1 hypothetical protein -
  WHP67_RS07825 (WHP67_07825) - 1475425..1475739 (+) 315 WP_002787295.1 hypothetical protein -
  WHP67_RS07830 (WHP67_07830) - 1475676..1476437 (+) 762 WP_002787298.1 hypothetical protein -
  WHP67_RS07835 (WHP67_07835) - 1476446..1476670 (+) 225 WP_002787300.1 hypothetical protein -
  WHP67_RS07840 (WHP67_07840) - 1476671..1477042 (+) 372 WP_002858334.1 hypothetical protein -
  WHP67_RS07845 (WHP67_07845) - 1477026..1477292 (+) 267 WP_002787304.1 hypothetical protein -
  WHP67_RS07850 (WHP67_07850) - 1477270..1478025 (+) 756 WP_002787306.1 site-specific DNA-methyltransferase -
  WHP67_RS07855 (WHP67_07855) - 1478043..1478396 (+) 354 WP_002787307.1 hypothetical protein -
  WHP67_RS07860 (WHP67_07860) - 1478398..1478604 (+) 207 WP_002787309.1 helix-turn-helix domain-containing protein -
  WHP67_RS07865 (WHP67_07865) - 1478601..1479776 (-) 1176 WP_002787311.1 site-specific integrase -
  WHP67_RS07875 (WHP67_07875) mrdB 1480115..1481215 (-) 1101 WP_002864601.1 FtsW/RodA/SpoVE family cell cycle protein -
  WHP67_RS07880 (WHP67_07880) - 1481293..1482261 (+) 969 WP_002858282.1 RluA family pseudouridine synthase -
  WHP67_RS07885 (WHP67_07885) - 1482206..1483441 (+) 1236 WP_010891920.1 fibronectin type III domain-containing protein -

Sequence


Protein


Download         Length: 217 a.a.        Molecular weight: 25719.25 Da        Isoelectric Point: 9.7797

>NTDB_id=952562 WHP67_RS07755 WP_019109051.1 1467321..1467974(-) (CJE1441) [Campylobacter jejuni strain Z1323CCJ0074]
MKKLTILFLLATLAFADYTQYKPSEEFAKYFTKQNCSQVLDKFYYLNCYDYDYKGTKAVAYRLEAENLRGKQIKKRPRFE
DDTNIPKKYRTTWSDYKHSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRIWNKIEKRERQLALKLGSLEVL
NLINYDNNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF

Nucleotide


Download         Length: 654 bp        

>NTDB_id=952562 WHP67_RS07755 WP_019109051.1 1467321..1467974(-) (CJE1441) [Campylobacter jejuni strain Z1323CCJ0074]
ATGAAAAAACTTACAATCTTATTCTTACTAGCAACTCTAGCTTTTGCTGATTATACACAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAACAAAATTGCTCACAAGTTTTAGACAAATTCTATTATCTAAATTGTTACGATTATGATTATA
AAGGGACAAAAGCAGTAGCTTATAGATTAGAAGCAGAAAATCTAAGAGGCAAACAAATTAAAAAGCGTCCTCGTTTTGAA
GATGATACCAATATTCCTAAAAAATACCGCACCACTTGGAGCGATTATAAGCATAGCGGTTATGATAGAGGGCATACTCT
TTCTAATGCCTCTATGAGAAAAACCACTCAAGCACAAAGAAGCACTTTTTTAATGAGCAATATCACTCCACAAAATCCAC
AAATTAACCAAAGGATTTGGAATAAGATTGAAAAACGCGAAAGACAACTAGCTTTAAAACTCGGAAGTTTAGAAGTTTTA
AATTTAATCAATTATGATAATAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE1441 Campylobacter jejuni RM1221

89.862

100

0.899

  CJE0566 Campylobacter jejuni RM1221

87.442

99.078

0.866