Detailed information    

experimental Experimentally validated

Overview

Name   CJE0566   Type   Regulator
Locus tag   CJE_RS02830 Genome accession   NC_003912
Coordinates   510498..511151 (-) Length   217 a.a.
NCBI ID   WP_011049704.1    Uniprot ID   A0A5T0PT72
Organism   Campylobacter jejuni RM1221     
Function   repress natural transformation   
Competence regulation

Function

Genetic transfer of the genes to a naturally transformable C. jejuni strain resulted in a decreased efficiency of natural transformation.


Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 498700..529013 510498..511151 within 0


Gene organization within MGE regions


Location: 498700..529013
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJE_RS02725 (CJE0544) - 498700..499902 (+) 1203 WP_011049686.1 tyrosine-type recombinase/integrase -
  CJE_RS02730 (CJE0545) - 499899..500069 (-) 171 WP_011049687.1 helix-turn-helix transcriptional regulator -
  CJE_RS02735 (CJE0546) - 500062..500604 (-) 543 WP_011049688.1 pentapeptide repeat-containing protein -
  CJE_RS02740 (CJE0547) - 500614..500796 (-) 183 WP_041176813.1 hypothetical protein -
  CJE_RS10055 - 500793..501128 (-) 336 WP_041176814.1 hypothetical protein -
  CJE_RS09535 (CJE0548) - 501182..501799 (-) 618 WP_011049690.1 antA/AntB antirepressor family protein -
  CJE_RS02755 (CJE0549) - 501935..502330 (-) 396 WP_011049691.1 hypothetical protein -
  CJE_RS02760 (CJE0550) - 502374..503126 (-) 753 WP_011049692.1 DNA-methyltransferase -
  CJE_RS02765 (CJE0551) - 503107..503547 (-) 441 WP_011049693.1 DUF3310 domain-containing protein -
  CJE_RS02770 (CJE0553) - 503790..504053 (-) 264 WP_011049695.1 hypothetical protein -
  CJE_RS02775 (CJE0554) - 504034..504729 (-) 696 WP_011049696.1 hypothetical protein -
  CJE_RS02780 (CJE0555) - 504729..505466 (-) 738 WP_002873576.1 hypothetical protein -
  CJE_RS02785 (CJE0556) - 505468..506322 (-) 855 WP_011049697.1 lambda-exonuclease family protein -
  CJE_RS02790 (CJE0557) - 506324..506551 (-) 228 WP_002874355.1 helix-turn-helix domain-containing protein -
  CJE_RS02795 (CJE0558) - 506542..506799 (-) 258 WP_002865124.1 hypothetical protein -
  CJE_RS02800 (CJE0559) - 506790..507059 (-) 270 WP_002874357.1 hypothetical protein -
  CJE_RS02805 (CJE0561) - 507621..507893 (-) 273 WP_011049699.1 hypothetical protein -
  CJE_RS02810 (CJE0562) - 508073..508843 (+) 771 WP_041176815.1 SEL1-like repeat protein -
  CJE_RS02815 (CJE0563) - 508862..509245 (-) 384 WP_041176816.1 hypothetical protein -
  CJE_RS02820 (CJE0564) - 509223..509756 (-) 534 WP_011049702.1 hypothetical protein -
  CJE_RS02825 (CJE0565) - 509753..510418 (-) 666 WP_011049703.1 hypothetical protein -
  CJE_RS02830 (CJE0566) CJE0566 510498..511151 (-) 654 WP_011049704.1 DNA/RNA non-specific endonuclease Regulator
  CJE_RS02835 (CJE0567) - 511157..511864 (-) 708 WP_052805202.1 hypothetical protein -
  CJE_RS02840 (CJE0568) - 511857..512645 (-) 789 WP_011049706.1 HipA family kinase -
  CJE_RS02845 (CJE0569) - 512642..513376 (-) 735 WP_011049707.1 S24 family peptidase -
  CJE_RS09610 (CJE0570) - 513488..513712 (+) 225 WP_011049708.1 hypothetical protein -
  CJE_RS02850 (CJE0571) - 513709..514137 (+) 429 WP_011049709.1 hypothetical protein -
  CJE_RS02855 (CJE0572) - 514134..514511 (+) 378 WP_011049710.1 hypothetical protein -
  CJE_RS02860 (CJE0573) - 514508..515509 (+) 1002 WP_011049711.1 hypothetical protein -
  CJE_RS02865 (CJE0574) - 515520..516167 (+) 648 WP_002873344.1 hypothetical protein -
  CJE_RS02870 (CJE0575) - 516185..516565 (+) 381 WP_011049712.1 hypothetical protein -
  CJE_RS02875 (CJE0576) - 516565..516951 (+) 387 WP_002861661.1 terminase small subunit -
  CJE_RS02880 (CJE0577) - 516948..518240 (+) 1293 WP_011049713.1 terminase -
  CJE_RS02885 (CJE0578) - 518230..518502 (+) 273 WP_002781524.1 hypothetical protein -
  CJE_RS02890 (CJE0579) - 518483..520021 (+) 1539 WP_011049714.1 portal protein -
  CJE_RS02895 (CJE0580) - 520014..520217 (+) 204 WP_000931940.1 hypothetical protein -
  CJE_RS02900 (CJE0581) - 520207..520854 (+) 648 WP_002791793.1 hypothetical protein -
  CJE_RS02905 (CJE0582) - 520865..521242 (+) 378 WP_011049715.1 hypothetical protein -
  CJE_RS02910 (CJE0583) - 521507..522718 (+) 1212 WP_011049716.1 hypothetical protein -
  CJE_RS02915 (CJE0584) - 522718..526419 (+) 3702 WP_011049717.1 PBECR2 nuclease fold domain-containing protein -
  CJE_RS02920 (CJE0585) - 526698..527402 (-) 705 WP_187145847.1 hypothetical protein -
  CJE_RS02925 (CJE0586) - 527553..527759 (-) 207 WP_002801300.1 hypothetical protein -
  CJE_RS02930 (CJE0587) - 527979..529013 (+) 1035 WP_011049719.1 SU10 major capsid protein -

Sequence

Protein


Download         Length: 217 a.a.        Molecular weight: 25608.19 Da        Isoelectric Point: 9.7916

>NTDB_id=1224 CJE_RS02830 WP_011049704.1 510498..511151(-) (CJE0566) [Campylobacter jejuni RM1221]
MKKLILLPLLSTLAFADYTQYKPSEEFAKYFTKQSCSQVLDKFYYLNCYDYNLKGTKAVAYKLEVDNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVASKLGSLEVL
NLVNYDNNPQRIRNQIAIPSSYIKILKGENFKECYQVPNHEVEDENIRKYKIDCDKI

Nucleotide


Download         Length: 654 bp        

>NTDB_id=1224 CJE_RS02830 WP_011049704.1 510498..511151(-) (CJE0566) [Campylobacter jejuni RM1221]
ATGAAAAAACTCATACTTTTACCATTGTTATCCACTCTAGCTTTTGCTGACTATACGCAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAGCAAAGTTGTTCGCAAGTTTTAGATAAATTCTATTATCTAAATTGCTATGATTATAATCTAA
AAGGTACTAAAGCAGTGGCTTATAAATTAGAAGTAGATAATCTAAAAGGCGAACAAATCAAAAAGCGCCCGCGCTTTGAA
GATGATACAAATATCCCTAAAAAATATCGTACCACTTGGAGTGATTATAAAAATAGTGGTTATGATAGAGGACACACTCT
TTCTAATGCCTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACATTCTTAATGAGTAATATTACTCCACAAAATCCAC
AAATCAATCAAAGGGTTTGGAACAAGATTGAAAAAAGAGAAAGACAAGTAGCTTCAAAGCTTGGAAGTTTAGAAGTTTTA
AATTTAGTTAATTATGACAATAATCCACAAAGAATAAGAAATCAAATTGCTATTCCAAGCTCTTATATTAAAATCTTAAA
AGGTGAGAATTTTAAAGAATGTTACCAAGTACCAAATCATGAAGTTGAAGATGAGAATATAAGAAAATATAAGATTGATT
GTGATAAAATATAA

Domains

Predicted by InterproScan.

DNA/RNA non-specific endonuclease (Endonuclease_NS)

(25-216)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5T0PT72

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE1441 Campylobacter jejuni RM1221

91.163

99.078

0.903

Multiple sequence alignment    



References

[1] Esther J Gaasbeek et al. (2010) Nucleases encoded by the integrated elements CJIE2 and CJIE4 inhibit natural transformation of Campylobacter jejuni. Journal of Bacteriology 192(4):936-41. [PMID: 20023031]