Detailed information    

experimental Experimentally validated

Overview

Name   CJE1441   Type   Regulator
Locus tag   CJE_RS07175 Genome accession   NC_003912
Coordinates   1346482..1347135 (+) Length   217 a.a.
NCBI ID   WP_011049930.1    Uniprot ID   A0A3X8NAQ4
Organism   Campylobacter jejuni RM1221     
Function   repress natural transformation   
Competence regulation

Function

Genetic transfer of the genes to a naturally transformable C. jejuni strain resulted in a decreased efficiency of natural transformation.


Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1328365..1382656 1346482..1347135 within 0


Gene organization within MGE regions


Location: 1328365..1382656
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CJE_RS07035 (CJE1411) - 1328365..1329558 (-) 1194 WP_002867342.1 murein hydrolase activator EnvC family protein -
  CJE_RS07040 (CJE1412) - 1329555..1330361 (-) 807 WP_002867341.1 ABC transporter permease -
  CJE_RS07045 (CJE1413) - 1330348..1331013 (-) 666 WP_002856386.1 cell division ATP-binding protein FtsE -
  CJE_RS07050 (CJE1414) trmB 1331083..1332261 (-) 1179 WP_011049923.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -
  CJE_RS07055 (CJE1415) - 1332261..1333496 (-) 1236 WP_074482847.1 fibronectin type III domain-containing protein -
  CJE_RS07060 (CJE1416) - 1333441..1334409 (-) 969 WP_002867338.1 RluA family pseudouridine synthase -
  CJE_RS07065 (CJE1417) mrdB 1334487..1335587 (+) 1101 WP_002887899.1 FtsW/RodA/SpoVE family cell cycle protein -
  CJE_RS07075 (CJE1418) - 1335926..1337101 (+) 1176 WP_002787311.1 tyrosine-type recombinase/integrase -
  CJE_RS07080 (CJE1419) - 1337098..1337304 (-) 207 WP_002787309.1 helix-turn-helix transcriptional regulator -
  CJE_RS07085 (CJE1420) - 1337306..1337659 (-) 354 WP_002787307.1 hypothetical protein -
  CJE_RS07090 (CJE1421) - 1337677..1338432 (-) 756 WP_002787306.1 DNA-methyltransferase -
  CJE_RS07095 (CJE1422) - 1338410..1338676 (-) 267 WP_002787304.1 hypothetical protein -
  CJE_RS07100 (CJE1423) - 1338660..1339031 (-) 372 WP_002858334.1 hypothetical protein -
  CJE_RS07105 (CJE1424) - 1339032..1339256 (-) 225 WP_011049924.1 hypothetical protein -
  CJE_RS07110 - 1339265..1340026 (-) 762 WP_002869676.1 hypothetical protein -
  CJE_RS07115 (CJE1426) - 1339963..1340277 (-) 315 WP_002787295.1 hypothetical protein -
  CJE_RS07120 (CJE1427) - 1340356..1340676 (-) 321 WP_002787293.1 hypothetical protein -
  CJE_RS07125 (CJE1429) - 1341064..1341300 (-) 237 WP_002787289.1 hypothetical protein -
  CJE_RS07130 (CJE1430) - 1341314..1342081 (-) 768 WP_002787287.1 hypothetical protein -
  CJE_RS07135 - 1342219..1342449 (-) 231 WP_002787283.1 hypothetical protein -
  CJE_RS07140 (CJE1433) - 1342415..1342678 (-) 264 WP_002787281.1 hypothetical protein -
  CJE_RS07145 (CJE1434) - 1342735..1343022 (-) 288 WP_002787279.1 YopX family protein -
  CJE_RS07150 (CJE1435) - 1343075..1343806 (-) 732 WP_011049928.1 phage regulatory protein/antirepressor Ant -
  CJE_RS07155 (CJE1436) - 1344237..1344521 (-) 285 WP_002912332.1 hypothetical protein -
  CJE_RS07160 (CJE1438) - 1344518..1344721 (-) 204 WP_002870299.1 hypothetical protein -
  CJE_RS07165 (CJE1439) - 1344926..1345579 (+) 654 WP_002870336.1 hypothetical protein -
  CJE_RS07170 (CJE1440) - 1345814..1346476 (+) 663 WP_002870274.1 S24 family peptidase -
  CJE_RS07175 (CJE1441) CJE1441 1346482..1347135 (+) 654 WP_011049930.1 DNA/RNA non-specific endonuclease Regulator
  CJE_RS07180 (CJE1442) - 1347152..1347433 (+) 282 WP_002870263.1 PLDc N-terminal domain-containing protein -
  CJE_RS09755 (CJE1443) - 1347447..1347644 (-) 198 WP_002913413.1 hypothetical protein -
  CJE_RS07185 (CJE1444) - 1347562..1347981 (-) 420 WP_002870261.1 hypothetical protein -
  CJE_RS07190 (CJE1445) - 1348210..1348671 (-) 462 WP_002870260.1 DUF5675 family protein -
  CJE_RS07195 (CJE1447) - 1348720..1350003 (-) 1284 WP_011049931.1 hypothetical protein -
  CJE_RS07200 (CJE1448) - 1350000..1350374 (-) 375 WP_011049932.1 DUF1353 domain-containing protein -
  CJE_RS07205 (CJE1449) - 1350367..1350750 (-) 384 WP_002869963.1 hypothetical protein -
  CJE_RS07210 (CJE1450) - 1350747..1351382 (-) 636 WP_002789149.1 DUF4376 domain-containing protein -
  CJE_RS07215 (CJE1451) - 1351395..1351844 (-) 450 WP_002798141.1 hypothetical protein -
  CJE_RS07220 (CJE1452) - 1351846..1353411 (-) 1566 WP_011049933.1 coiled-coil domain-containing protein -
  CJE_RS07225 (CJE1453) - 1353404..1354036 (-) 633 WP_002869967.1 hypothetical protein -
  CJE_RS07230 (CJE1454) - 1354033..1354350 (-) 318 WP_002788295.1 phage head completion protein -
  CJE_RS07235 (CJE1455) - 1354363..1354800 (-) 438 WP_002788293.1 phage gp6-like head-tail connector protein -
  CJE_RS07240 (CJE1457) - 1354797..1355048 (-) 252 WP_002788291.1 hypothetical protein -
  CJE_RS07245 (CJE1458) - 1355059..1356225 (-) 1167 WP_002788288.1 phage major capsid protein -
  CJE_RS07250 (CJE1459) - 1356242..1356799 (-) 558 WP_002788287.1 HK97 family phage prohead protease -
  CJE_RS07255 (CJE1460) - 1356885..1357754 (-) 870 WP_002788286.1 hypothetical protein -
  CJE_RS07260 (CJE1461) - 1357767..1363466 (-) 5700 WP_011049936.1 hypothetical protein -
  CJE_RS07265 (CJE1463) - 1363526..1363864 (+) 339 WP_002788283.1 hypothetical protein -
  CJE_RS07270 (CJE1464) - 1363856..1364071 (-) 216 WP_002788282.1 hypothetical protein -
  CJE_RS07275 (CJE1465) - 1364152..1364508 (-) 357 WP_002788281.1 hypothetical protein -
  CJE_RS07280 (CJE1466) - 1364505..1365485 (-) 981 WP_002788279.1 hypothetical protein -
  CJE_RS07285 (CJE1467) - 1365657..1366007 (-) 351 WP_002788276.1 hypothetical protein -
  CJE_RS07290 (CJE1468) - 1366008..1366550 (-) 543 WP_002800770.1 HK97 gp10 family phage protein -
  CJE_RS07295 (CJE1469) - 1366547..1367719 (-) 1173 WP_002788272.1 phage portal protein -
  CJE_RS07300 (CJE1470) - 1367879..1368313 (-) 435 WP_002913302.1 type II toxin-antitoxin system PemK/MazF family toxin -
  CJE_RS07305 (CJE1471) - 1368368..1369993 (-) 1626 WP_011049938.1 terminase large subunit -
  CJE_RS07310 (CJE1472) - 1369997..1370632 (-) 636 WP_011049939.1 P27 family phage terminase small subunit -
  CJE_RS07315 (CJE1473) - 1370883..1371233 (-) 351 WP_002869973.1 HNH endonuclease -
  CJE_RS07320 (CJE1474) - 1371220..1371510 (-) 291 WP_002788257.1 hypothetical protein -
  CJE_RS07330 (CJE1475) ktrB 1372261..1373604 (+) 1344 WP_002867336.1 TrkH family potassium uptake protein -
  CJE_RS07335 (CJE1476) ktrA 1373615..1374265 (+) 651 WP_002853664.1 potassium channel family protein -
  CJE_RS07340 (CJE1477) - 1374262..1374933 (-) 672 WP_002867335.1 MqnA/MqnD/SBP family protein -
  CJE_RS07345 (CJE1478) upp 1374939..1375565 (-) 627 WP_002867334.1 uracil phosphoribosyltransferase -
  CJE_RS07350 (CJE1479) - 1375562..1376797 (-) 1236 WP_002867333.1 malic enzyme-like NAD(P)-binding protein -
  CJE_RS07355 (CJE1480) gltX 1376799..1378190 (-) 1392 WP_011049940.1 glutamate--tRNA ligase -
  CJE_RS07360 (CJE1481) salC 1378255..1379070 (+) 816 WP_011049941.1 peptidylprolyl isomerase SalC -
  CJE_RS07365 (CJE1482) accC 1379107..1380438 (-) 1332 WP_002867331.1 acetyl-CoA carboxylase biotin carboxylase subunit -
  CJE_RS07370 (CJE1483) accB 1380440..1380895 (-) 456 WP_002853623.1 acetyl-CoA carboxylase biotin carboxyl carrier protein -
  CJE_RS07375 (CJE1484) dcd 1381043..1381603 (+) 561 WP_002859334.1 dCTP deaminase -
  CJE_RS07380 (CJE1485) pseB 1381652..1382656 (+) 1005 WP_002859335.1 UDP-N-acetylglucosamine 4,6-dehydratase (inverting) -

Sequence

Protein


Download         Length: 217 a.a.        Molecular weight: 25531.02 Da        Isoelectric Point: 9.8742

>NTDB_id=1225 CJE_RS07175 WP_011049930.1 1346482..1347135(+) (CJE1441) [Campylobacter jejuni RM1221]
MKKLIILSLLSTLAFADYTQYKPSEDFAKYFTKQNCSQVLDKFYYINCYDYSLKGTKAVAYRLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGSLEVL
NLVNYDNNPQRIKNNIAIPSSYTKILKGDNFKECYQVPNHDVENENLRIYKVKCDNF

Nucleotide


Download         Length: 654 bp        

>NTDB_id=1225 CJE_RS07175 WP_011049930.1 1346482..1347135(+) (CJE1441) [Campylobacter jejuni RM1221]
ATGAAAAAACTTATAATCTTATCTTTATTATCCACTCTAGCTTTTGCTGATTATACACAATACAAACCAAGCGAAGATTT
TGCCAAGTATTTTACTAAACAAAACTGCTCACAAGTTTTGGATAAATTTTATTATATTAATTGTTATGATTATTCTTTAA
AAGGCACTAAAGCCGTAGCTTATAGATTAGAAGCGGATAATTTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATTCCTAAAAAATACCGCACCACATGGAGTGATTATAAAAACAGCGGTTACGACAGGGGACACACTCT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCTCAAAGAAGCACTTTTTTAATGAGCAACATTACTCCACAAAATCCAC
AAATCAATCAAAGAGTTTGGAATAAAATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAAGTTTAGAAGTTTTA
AATTTGGTTAATTATGACAATAATCCACAAAGAATAAAAAACAATATTGCTATTCCAAGCTCTTACACTAAGATTTTAAA
AGGTGATAATTTTAAAGAATGTTACCAAGTGCCTAATCACGATGTAGAAAATGAGAATTTAAGAATATATAAAGTAAAAT
GTGACAATTTTTAA

Domains

Predicted by InterproScan.

DNA/RNA non-specific endonuclease (Endonuclease_NS)

(27-216)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A3X8NAQ4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE0566 Campylobacter jejuni RM1221

91.163

99.078

0.903

Multiple sequence alignment    



References

[1] Esther J Gaasbeek et al. (2010) Nucleases encoded by the integrated elements CJIE2 and CJIE4 inhibit natural transformation of Campylobacter jejuni. Journal of Bacteriology 192(4):936-41. [PMID: 20023031]