Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | AAA985_RS00670 | Genome accession | NZ_AP028603 |
| Coordinates | 108857..109015 (+) | Length | 52 a.a. |
| NCBI ID | WP_001093073.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain Pne2 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 103857..114015
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAA985_RS00640 (TKY181970_01240) | - | 103995..105005 (-) | 1011 | WP_000009171.1 | YeiH family protein | - |
| AAA985_RS00645 (TKY181970_01250) | - | 105154..106323 (+) | 1170 | WP_000366342.1 | pyridoxal phosphate-dependent aminotransferase | - |
| AAA985_RS00650 (TKY181970_01260) | recO | 106320..107090 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | Machinery gene |
| AAA985_RS00655 (TKY181970_01270) | plsX | 107087..108079 (+) | 993 | WP_000717467.1 | phosphate acyltransferase PlsX | - |
| AAA985_RS00660 (TKY181970_01280) | - | 108085..108318 (+) | 234 | WP_000136447.1 | acyl carrier protein | - |
| AAA985_RS00665 (TKY181970_01290) | - | 108364..108654 (+) | 291 | Protein_125 | IS5/IS1182 family transposase | - |
| AAA985_RS00670 (TKY181970_01300) | cipB | 108857..109015 (+) | 159 | WP_001093073.1 | bacteriocin class II family protein | Regulator |
| AAA985_RS00675 | - | 109018..109143 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| AAA985_RS00680 (TKY181970_01310) | comA | 109734..111887 (+) | 2154 | WP_000668282.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| AAA985_RS00685 (TKY181970_01320) | comB | 111900..113249 (+) | 1350 | WP_000801620.1 | competence pheromone export protein ComB | Regulator |
Sequence
Protein
Download Length: 52 a.a. Molecular weight: 5435.25 Da Isoelectric Point: 4.2644
>NTDB_id=95198 AAA985_RS00670 WP_001093073.1 108857..109015(+) (cipB) [Streptococcus pneumoniae strain Pne2]
MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAILGGVAYAATCWW
MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAILGGVAYAATCWW
Nucleotide
Download Length: 159 bp
>NTDB_id=95198 AAA985_RS00670 WP_001093073.1 108857..109015(+) (cipB) [Streptococcus pneumoniae strain Pne2]
ATGAATACAAAAAAGATGTCACAATTTGAAATTATGGATACTGAGATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGGAGATTTTGCCAAAGCAGGTGTTGGAGGAGGAGCTATACTTGGAGGTGTGGCCTATGCAGCGACATGTTGGTGGTAA
ATGAATACAAAAAAGATGTCACAATTTGAAATTATGGATACTGAGATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGGAGATTTTGCCAAAGCAGGTGTTGGAGGAGGAGCTATACTTGGAGGTGTGGCCTATGCAGCGACATGTTGGTGGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
44 |
96.154 |
0.423 |