Detailed information    

insolico Bioinformatically predicted

Overview

Name   CJE1441   Type   Regulator
Locus tag   WHQ26_RS06670 Genome accession   NZ_CP148155
Coordinates   1286754..1287374 (+) Length   206 a.a.
NCBI ID   WP_265606999.1    Uniprot ID   -
Organism   Campylobacter jejuni strain Z1323HCJ0069     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1266874..1298853 1286754..1287374 within 0


Gene organization within MGE regions


Location: 1266874..1298853
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHQ26_RS06535 (WHQ26_06535) - 1266874..1267908 (-) 1035 WP_265606992.1 DUF5309 family protein -
  WHQ26_RS06540 (WHQ26_06540) - 1268242..1268910 (-) 669 WP_044779949.1 Rha family transcriptional regulator -
  WHQ26_RS06545 (WHQ26_06545) - 1269061..1269270 (+) 210 WP_002846748.1 hypothetical protein -
  WHQ26_RS06550 (WHQ26_06550) - 1269394..1269864 (-) 471 WP_002865774.1 hypothetical protein -
  WHQ26_RS06555 (WHQ26_06555) - 1269857..1270084 (-) 228 WP_002865775.1 hypothetical protein -
  WHQ26_RS06560 (WHQ26_06560) - 1270368..1274048 (-) 3681 WP_265606993.1 PBECR2 nuclease fold domain-containing protein -
  WHQ26_RS06565 (WHQ26_06565) - 1274048..1275259 (-) 1212 WP_215447225.1 hypothetical protein -
  WHQ26_RS06570 (WHQ26_06570) - 1275524..1275903 (-) 380 Protein_1270 hypothetical protein -
  WHQ26_RS06575 (WHQ26_06575) - 1275914..1276561 (-) 648 WP_048818588.1 hypothetical protein -
  WHQ26_RS06580 (WHQ26_06580) - 1276551..1276754 (-) 204 WP_000931940.1 hypothetical protein -
  WHQ26_RS06585 (WHQ26_06585) - 1276747..1278285 (-) 1539 WP_338851111.1 hypothetical protein -
  WHQ26_RS06590 (WHQ26_06590) - 1278266..1278537 (-) 272 Protein_1274 hypothetical protein -
  WHQ26_RS06595 (WHQ26_06595) - 1278527..1278775 (-) 249 WP_338851112.1 hypothetical protein -
  WHQ26_RS06600 (WHQ26_06600) - 1278790..1279818 (-) 1029 WP_338851114.1 terminase family protein -
  WHQ26_RS06605 (WHQ26_06605) - 1279815..1280201 (-) 387 WP_002861661.1 terminase small subunit -
  WHQ26_RS06610 (WHQ26_06610) - 1280201..1280581 (-) 381 WP_002788333.1 hypothetical protein -
  WHQ26_RS06615 (WHQ26_06615) - 1280631..1281248 (-) 618 WP_338851115.1 hypothetical protein -
  WHQ26_RS06620 (WHQ26_06620) - 1281259..1282260 (-) 1002 WP_240367679.1 hypothetical protein -
  WHQ26_RS06625 (WHQ26_06625) - 1282303..1282668 (+) 366 WP_338851117.1 hypothetical protein -
  WHQ26_RS06630 (WHQ26_06630) - 1282805..1282954 (+) 150 WP_265606997.1 hypothetical protein -
  WHQ26_RS06635 (WHQ26_06635) - 1282951..1283139 (-) 189 WP_221676718.1 hypothetical protein -
  WHQ26_RS06640 (WHQ26_06640) - 1283136..1283354 (-) 219 WP_002826741.1 hypothetical protein -
  WHQ26_RS06645 (WHQ26_06645) - 1283466..1284199 (+) 734 Protein_1285 S24 family peptidase -
  WHQ26_RS06650 (WHQ26_06650) - 1284196..1284663 (+) 468 WP_338851118.1 hypothetical protein -
  WHQ26_RS06655 (WHQ26_06655) - 1285267..1285647 (+) 381 WP_052799449.1 hypothetical protein -
  WHQ26_RS06660 (WHQ26_06660) - 1285644..1286300 (+) 657 WP_052799450.1 hypothetical protein -
  WHQ26_RS06665 (WHQ26_06665) - 1286316..1286747 (+) 432 WP_052799451.1 protein-export chaperone SecB -
  WHQ26_RS06670 (WHQ26_06670) CJE1441 1286754..1287374 (+) 621 WP_265606999.1 DNA/RNA non-specific endonuclease Regulator
  WHQ26_RS06675 (WHQ26_06675) - 1287575..1288102 (-) 528 WP_338851120.1 hypothetical protein -
  WHQ26_RS06680 (WHQ26_06680) - 1288259..1288450 (+) 192 WP_002783990.1 hypothetical protein -
  WHQ26_RS06685 (WHQ26_06685) - 1288431..1288580 (-) 150 WP_002810114.1 hypothetical protein -
  WHQ26_RS06690 (WHQ26_06690) - 1288632..1288904 (+) 273 WP_002786773.1 hypothetical protein -
  WHQ26_RS06695 (WHQ26_06695) - 1289466..1289735 (+) 270 WP_002783984.1 hypothetical protein -
  WHQ26_RS06700 (WHQ26_06700) - 1289726..1289983 (+) 258 WP_057035888.1 hypothetical protein -
  WHQ26_RS06705 (WHQ26_06705) - 1289974..1290201 (+) 228 WP_265607001.1 helix-turn-helix domain-containing protein -
  WHQ26_RS06710 (WHQ26_06710) - 1290203..1291057 (+) 855 WP_011049697.1 YqaJ viral recombinase family protein -
  WHQ26_RS06715 (WHQ26_06715) - 1291059..1291796 (+) 738 WP_107840713.1 hypothetical protein -
  WHQ26_RS06720 (WHQ26_06720) - 1291796..1292490 (+) 695 Protein_1300 hypothetical protein -
  WHQ26_RS06725 (WHQ26_06725) - 1292471..1292719 (+) 249 WP_338851192.1 hypothetical protein -
  WHQ26_RS06730 (WHQ26_06730) - 1292729..1293169 (+) 441 WP_002801610.1 YopX family protein -
  WHQ26_RS06735 (WHQ26_06735) - 1293172..1293507 (+) 336 WP_002874350.1 hypothetical protein -
  WHQ26_RS06740 (WHQ26_06740) - 1293510..1294262 (+) 753 WP_052819867.1 site-specific DNA-methyltransferase -
  WHQ26_RS06745 (WHQ26_06745) - 1294316..1295155 (+) 840 WP_002861640.1 hypothetical protein -
  WHQ26_RS06750 (WHQ26_06750) - 1295166..1295459 (+) 294 WP_038401075.1 hypothetical protein -
  WHQ26_RS06755 (WHQ26_06755) - 1295469..1295705 (+) 237 WP_265607003.1 hypothetical protein -
  WHQ26_RS06760 (WHQ26_06760) - 1295786..1296007 (+) 222 WP_126212323.1 helix-turn-helix transcriptional regulator -
  WHQ26_RS06765 (WHQ26_06765) - 1296516..1297172 (+) 657 WP_338851121.1 hypothetical protein -
  WHQ26_RS06770 (WHQ26_06770) - 1297174..1297716 (+) 543 WP_052799456.1 pentapeptide repeat-containing protein -
  WHQ26_RS06775 (WHQ26_06775) - 1297709..1297879 (+) 171 WP_002864902.1 helix-turn-helix domain-containing protein -
  WHQ26_RS06780 (WHQ26_06780) - 1297876..1298853 (-) 978 WP_338851122.1 site-specific integrase -

Sequence

Protein


Download         Length: 206 a.a.        Molecular weight: 24068.52 Da        Isoelectric Point: 9.7686

>NTDB_id=951883 WHQ26_RS06670 WP_265606999.1 1286754..1287374(+) (CJE1441) [Campylobacter jejuni strain Z1323HCJ0069]
MKKLIILPLLATLALADYTQYKPSEDFAKYFTKQNCSQVLDKFYYLNCYDYNLKGTKAVAYKLEADNLKGEQIKKRPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTISNASMRKTTQAQRSTFLMSNITPQNPQINQRVWNKIEKRERQVALKLGEIEVL
NLVNYDSNPINISDTEIIDFEINNNLILKNIAIKNKISGKIDLYNF

Nucleotide


Download         Length: 621 bp        

>NTDB_id=951883 WHQ26_RS06670 WP_265606999.1 1286754..1287374(+) (CJE1441) [Campylobacter jejuni strain Z1323HCJ0069]
ATGAAAAAACTTATAATCTTACCACTGCTAGCAACTCTAGCCTTAGCTGATTATACACAATACAAGCCAAGCGAAGATTT
TGCTAAGTATTTTACTAAGCAAAACTGCTCACAAGTTTTAGATAAGTTTTATTATCTAAATTGCTATGATTATAATCTAA
AAGGCACTAAAGCTGTAGCTTATAAATTAGAAGCAGATAATTTAAAAGGCGAACAAATCAAAAAACGCCCACGCTTTGAA
GATGATACAAATATACCTAAAAAATACCGCACTACATGGAGTGATTATAAAAACAGCGGTTATGATAGAGGGCATACTAT
TTCTAATGCTTCAATGAGAAAAACAACCCAAGCTCAAAGAAGCACTTTTTTAATGAGTAATATTACTCCGCAAAATCCAC
AGATCAATCAAAGGGTTTGGAACAAGATTGAAAAAAGAGAAAGACAAGTAGCTTTAAAGCTTGGAGAAATTGAAGTTTTA
AATTTGGTTAATTATGATAGCAACCCTATTAATATTAGTGATACAGAAATTATAGACTTTGAAATTAATAATAATTTGAT
ATTAAAAAATATAGCTATTAAAAATAAAATATCAGGCAAAATAGATTTATATAATTTTTAA

Domains

Predicted by InterproScan.

DNA/RNA non-specific endonuclease (Endonuclease_NS)

(27-168)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE1441 Campylobacter jejuni RM1221

93.023

83.495

0.777
  CJE0566 Campylobacter jejuni RM1221

92.442

83.495

0.772