Detailed information
Bioinformatically predicted
Overview
| Name | CJE1441 | Type | Regulator |
| Locus tag | WHP77_RS04410 | Genome accession | NZ_CP148153 |
| Coordinates | 842256..842909 (-) | Length | 217 a.a. |
| NCBI ID | WP_019109051.1 | Uniprot ID | - |
| Organism | Campylobacter jejuni strain Z1323PCJ0002 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 817949..858376 | 842256..842909 | within | 0 |
Gene organization within MGE regions
Location: 817949..858376
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WHP77_RS04260 (WHP77_04260) | - | 817949..818239 (+) | 291 | WP_002788257.1 | hypothetical protein | - |
| WHP77_RS04265 (WHP77_04265) | - | 818226..818567 (+) | 342 | WP_002788260.1 | HNH endonuclease signature motif containing protein | - |
| WHP77_RS04270 (WHP77_04270) | - | 818827..819462 (+) | 636 | WP_002788261.1 | P27 family phage terminase small subunit | - |
| WHP77_RS04275 (WHP77_04275) | - | 819466..821091 (+) | 1626 | WP_002788263.1 | terminase TerL endonuclease subunit | - |
| WHP77_RS04280 (WHP77_04280) | - | 821146..821580 (+) | 435 | WP_002788265.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| WHP77_RS04285 (WHP77_04285) | - | 821740..822912 (+) | 1173 | WP_002788272.1 | phage portal protein | - |
| WHP77_RS04290 (WHP77_04290) | - | 822909..823451 (+) | 543 | WP_002864096.1 | HK97 gp10 family phage protein | - |
| WHP77_RS04295 (WHP77_04295) | - | 823452..823802 (+) | 351 | WP_002788276.1 | hypothetical protein | - |
| WHP77_RS04300 (WHP77_04300) | - | 823974..824954 (+) | 981 | WP_002858135.1 | hypothetical protein | - |
| WHP77_RS04305 (WHP77_04305) | - | 824951..825307 (+) | 357 | WP_002788281.1 | hypothetical protein | - |
| WHP77_RS04310 (WHP77_04310) | - | 825388..825603 (+) | 216 | WP_002788282.1 | hypothetical protein | - |
| WHP77_RS04315 (WHP77_04315) | - | 825595..825933 (-) | 339 | WP_002788283.1 | hypothetical protein | - |
| WHP77_RS04320 (WHP77_04320) | - | 825993..831719 (+) | 5727 | WP_002800774.1 | hypothetical protein | - |
| WHP77_RS04325 (WHP77_04325) | - | 831732..832601 (+) | 870 | WP_002788286.1 | hypothetical protein | - |
| WHP77_RS04330 (WHP77_04330) | - | 832687..833244 (+) | 558 | WP_002788287.1 | HK97 family phage prohead protease | - |
| WHP77_RS04335 (WHP77_04335) | - | 833261..834427 (+) | 1167 | WP_002788288.1 | phage major capsid protein | - |
| WHP77_RS04340 (WHP77_04340) | - | 834438..834689 (+) | 252 | WP_002788291.1 | hypothetical protein | - |
| WHP77_RS04345 (WHP77_04345) | - | 834686..835123 (+) | 438 | WP_002788293.1 | phage gp6-like head-tail connector protein | - |
| WHP77_RS04350 (WHP77_04350) | - | 835136..835453 (+) | 318 | WP_002788295.1 | head-tail adaptor protein | - |
| WHP77_RS04355 (WHP77_04355) | - | 835450..836082 (+) | 633 | WP_002788297.1 | hypothetical protein | - |
| WHP77_RS04360 (WHP77_04360) | - | 836075..837640 (+) | 1566 | WP_002858267.1 | hypothetical protein | - |
| WHP77_RS04365 (WHP77_04365) | - | 837642..838091 (+) | 450 | WP_070313924.1 | hypothetical protein | - |
| WHP77_RS04370 (WHP77_04370) | - | 838104..838739 (+) | 636 | WP_070310085.1 | DUF4376 domain-containing protein | - |
| WHP77_RS04375 (WHP77_04375) | - | 838736..839200 (+) | 465 | WP_002801917.1 | hypothetical protein | - |
| WHP77_RS04380 (WHP77_04380) | - | 839190..839561 (+) | 372 | WP_002801918.1 | DUF1353 domain-containing protein | - |
| WHP77_RS04385 (WHP77_04385) | - | 839558..840841 (+) | 1284 | WP_002801920.1 | hypothetical protein | - |
| WHP77_RS04390 (WHP77_04390) | - | 840890..841348 (+) | 459 | WP_002858146.1 | DUF5675 family protein | - |
| WHP77_RS04395 (WHP77_04395) | - | 841410..841829 (+) | 420 | WP_002857883.1 | hypothetical protein | - |
| WHP77_RS04400 (WHP77_04400) | - | 841747..841944 (+) | 198 | WP_002870262.1 | hypothetical protein | - |
| WHP77_RS04405 (WHP77_04405) | - | 841958..842239 (-) | 282 | WP_002870263.1 | PLDc N-terminal domain-containing protein | - |
| WHP77_RS04410 (WHP77_04410) | CJE1441 | 842256..842909 (-) | 654 | WP_019109051.1 | DNA/RNA non-specific endonuclease | Regulator |
| WHP77_RS04415 (WHP77_04415) | - | 842915..843736 (-) | 822 | WP_052774273.1 | hypothetical protein | - |
| WHP77_RS04420 (WHP77_04420) | - | 843726..843965 (-) | 240 | WP_019108957.1 | hypothetical protein | - |
| WHP77_RS04425 (WHP77_04425) | - | 844162..844824 (-) | 663 | WP_019108958.1 | S24/S26 family peptidase | - |
| WHP77_RS04430 (WHP77_04430) | - | 845059..845712 (-) | 654 | WP_019108959.1 | hypothetical protein | - |
| WHP77_RS04435 (WHP77_04435) | - | 845916..846119 (+) | 204 | WP_002858450.1 | hypothetical protein | - |
| WHP77_RS04440 (WHP77_04440) | - | 846116..846400 (+) | 285 | WP_002788580.1 | hypothetical protein | - |
| WHP77_RS04445 (WHP77_04445) | - | 846831..847562 (+) | 732 | WP_002801548.1 | phage regulatory protein/antirepressor Ant | - |
| WHP77_RS04450 (WHP77_04450) | - | 847615..847902 (+) | 288 | WP_002787279.1 | YopX family protein | - |
| WHP77_RS04455 (WHP77_04455) | - | 847959..848222 (+) | 264 | WP_002787281.1 | hypothetical protein | - |
| WHP77_RS04460 (WHP77_04460) | - | 848188..848418 (+) | 231 | WP_002787283.1 | hypothetical protein | - |
| WHP77_RS04465 (WHP77_04465) | - | 848556..849323 (+) | 768 | WP_002787287.1 | hypothetical protein | - |
| WHP77_RS04470 (WHP77_04470) | - | 849337..849573 (+) | 237 | WP_002787289.1 | hypothetical protein | - |
| WHP77_RS04475 (WHP77_04475) | - | 849961..850281 (+) | 321 | WP_002787293.1 | hypothetical protein | - |
| WHP77_RS04480 (WHP77_04480) | - | 850360..850674 (+) | 315 | WP_002787295.1 | hypothetical protein | - |
| WHP77_RS04485 (WHP77_04485) | - | 850611..851372 (+) | 762 | WP_002787298.1 | hypothetical protein | - |
| WHP77_RS04490 (WHP77_04490) | - | 851381..851605 (+) | 225 | WP_002787300.1 | hypothetical protein | - |
| WHP77_RS04495 (WHP77_04495) | - | 851606..851977 (+) | 372 | WP_002858334.1 | hypothetical protein | - |
| WHP77_RS04500 (WHP77_04500) | - | 851961..852227 (+) | 267 | WP_002787304.1 | hypothetical protein | - |
| WHP77_RS04505 (WHP77_04505) | - | 852205..852960 (+) | 756 | WP_002787306.1 | site-specific DNA-methyltransferase | - |
| WHP77_RS04510 (WHP77_04510) | - | 852978..853331 (+) | 354 | WP_002787307.1 | hypothetical protein | - |
| WHP77_RS04515 (WHP77_04515) | - | 853333..853539 (+) | 207 | WP_002787309.1 | helix-turn-helix domain-containing protein | - |
| WHP77_RS04520 (WHP77_04520) | - | 853536..854711 (-) | 1176 | WP_002787311.1 | site-specific integrase | - |
| WHP77_RS04530 (WHP77_04530) | mrdB | 855050..856150 (-) | 1101 | WP_002864601.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| WHP77_RS04535 (WHP77_04535) | - | 856228..857196 (+) | 969 | WP_002858282.1 | RluA family pseudouridine synthase | - |
| WHP77_RS04540 (WHP77_04540) | - | 857141..858376 (+) | 1236 | WP_338844397.1 | fibronectin type III domain-containing protein | - |
Sequence
Protein
Download Length: 217 a.a. Molecular weight: 25719.25 Da Isoelectric Point: 9.7797
>NTDB_id=951819 WHP77_RS04410 WP_019109051.1 842256..842909(-) (CJE1441) [Campylobacter jejuni strain Z1323PCJ0002]
MKKLTILFLLATLAFADYTQYKPSEEFAKYFTKQNCSQVLDKFYYLNCYDYDYKGTKAVAYRLEAENLRGKQIKKRPRFE
DDTNIPKKYRTTWSDYKHSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRIWNKIEKRERQLALKLGSLEVL
NLINYDNNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF
MKKLTILFLLATLAFADYTQYKPSEEFAKYFTKQNCSQVLDKFYYLNCYDYDYKGTKAVAYRLEAENLRGKQIKKRPRFE
DDTNIPKKYRTTWSDYKHSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQRIWNKIEKRERQLALKLGSLEVL
NLINYDNNPQRIKNNIAVPSSYVKILKGDNFKECYQVPNHEVDDESIRIYKVQCDNF
Nucleotide
Download Length: 654 bp
>NTDB_id=951819 WHP77_RS04410 WP_019109051.1 842256..842909(-) (CJE1441) [Campylobacter jejuni strain Z1323PCJ0002]
ATGAAAAAACTTACAATCTTATTCTTACTAGCAACTCTAGCTTTTGCTGATTATACACAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAACAAAATTGCTCACAAGTTTTAGACAAATTCTATTATCTAAATTGTTACGATTATGATTATA
AAGGGACAAAAGCAGTAGCTTATAGATTAGAAGCAGAAAATCTAAGAGGCAAACAAATTAAAAAGCGTCCTCGTTTTGAA
GATGATACCAATATTCCTAAAAAATACCGCACCACTTGGAGCGATTATAAGCATAGCGGTTATGATAGAGGGCATACTCT
TTCTAATGCCTCTATGAGAAAAACCACTCAAGCACAAAGAAGCACTTTTTTAATGAGCAATATCACTCCACAAAATCCAC
AAATTAACCAAAGGATTTGGAATAAGATTGAAAAACGCGAAAGACAACTAGCTTTAAAACTCGGAAGTTTAGAAGTTTTA
AATTTAATCAATTATGATAATAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA
ATGAAAAAACTTACAATCTTATTCTTACTAGCAACTCTAGCTTTTGCTGATTATACACAATATAAACCAAGCGAAGAGTT
TGCTAAGTATTTTACTAAACAAAATTGCTCACAAGTTTTAGACAAATTCTATTATCTAAATTGTTACGATTATGATTATA
AAGGGACAAAAGCAGTAGCTTATAGATTAGAAGCAGAAAATCTAAGAGGCAAACAAATTAAAAAGCGTCCTCGTTTTGAA
GATGATACCAATATTCCTAAAAAATACCGCACCACTTGGAGCGATTATAAGCATAGCGGTTATGATAGAGGGCATACTCT
TTCTAATGCCTCTATGAGAAAAACCACTCAAGCACAAAGAAGCACTTTTTTAATGAGCAATATCACTCCACAAAATCCAC
AAATTAACCAAAGGATTTGGAATAAGATTGAAAAACGCGAAAGACAACTAGCTTTAAAACTCGGAAGTTTAGAAGTTTTA
AATTTAATCAATTATGATAATAATCCACAAAGAATAAAAAACAATATAGCTGTGCCAAGCTCTTATGTTAAGATCTTAAA
AGGTGATAATTTTAAAGAATGTTATCAAGTGCCAAATCATGAAGTCGATGATGAGAGTATAAGAATATATAAGGTACAAT
GTGACAATTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| CJE1441 | Campylobacter jejuni RM1221 |
89.862 |
100 |
0.899 |
| CJE0566 | Campylobacter jejuni RM1221 |
87.442 |
99.078 |
0.866 |