Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   WHO18_RS13370 Genome accession   NZ_CP148128
Coordinates   2552032..2552205 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate FELIX_MS620     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547032..2557205
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO18_RS13355 gcvT 2547831..2548919 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WHO18_RS13360 yqhH 2549361..2551034 (+) 1674 WP_004398544.1 SNF2-related protein -
  WHO18_RS13365 yqhG 2551055..2551849 (+) 795 WP_003230200.1 YqhG family protein -
  WHO18_RS13370 sinI 2552032..2552205 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHO18_RS13375 sinR 2552239..2552574 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHO18_RS13380 tasA 2552667..2553452 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHO18_RS13385 sipW 2553516..2554088 (-) 573 WP_003246088.1 signal peptidase I -
  WHO18_RS13390 tapA 2554072..2554833 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHO18_RS13395 yqzG 2555105..2555431 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHO18_RS13400 spoIIT 2555473..2555652 (-) 180 WP_003230176.1 YqzE family protein -
  WHO18_RS13405 comGG 2555723..2556097 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHO18_RS13410 comGF 2556098..2556481 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHO18_RS13415 comGE 2556507..2556854 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=951446 WHO18_RS13370 WP_003230187.1 2552032..2552205(+) (sinI) [Bacillus subtilis isolate FELIX_MS620]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=951446 WHO18_RS13370 WP_003230187.1 2552032..2552205(+) (sinI) [Bacillus subtilis isolate FELIX_MS620]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1