Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WHO38_RS17220 Genome accession   NZ_CP148124
Coordinates   3255825..3255965 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate FELIX_MS521     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3250825..3260965
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO38_RS17195 yuxO 3251138..3251518 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO38_RS17200 comA 3251537..3252181 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO38_RS17205 comP 3252262..3254571 (-) 2310 WP_277723628.1 two-component system sensor histidine kinase ComP Regulator
  WHO38_RS17210 comX 3254586..3254753 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO38_RS17215 comQ 3254741..3255640 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO38_RS17220 degQ 3255825..3255965 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO38_RS17225 - 3256187..3256312 (+) 126 WP_003228793.1 hypothetical protein -
  WHO38_RS17230 - 3256426..3256794 (+) 369 WP_003243784.1 hypothetical protein -
  WHO38_RS17235 pdeH 3256770..3257999 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO38_RS17240 pncB 3258136..3259608 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHO38_RS17245 pncA 3259624..3260175 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHO38_RS17250 yueI 3260272..3260670 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=951340 WHO38_RS17220 WP_003220708.1 3255825..3255965(-) (degQ) [Bacillus subtilis isolate FELIX_MS521]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=951340 WHO38_RS17220 WP_003220708.1 3255825..3255965(-) (degQ) [Bacillus subtilis isolate FELIX_MS521]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1