Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WHO22_RS17250 Genome accession   NZ_CP148122
Coordinates   3256606..3256746 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate FELIX_MS513     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251606..3261746
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO22_RS17225 yuxO 3251919..3252299 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO22_RS17230 comA 3252318..3252962 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO22_RS17235 comP 3253043..3255352 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  WHO22_RS17240 comX 3255367..3255534 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO22_RS17245 comQ 3255522..3256421 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO22_RS17250 degQ 3256606..3256746 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO22_RS17255 - 3256968..3257093 (+) 126 WP_003228793.1 hypothetical protein -
  WHO22_RS17260 - 3257207..3257575 (+) 369 WP_003243784.1 hypothetical protein -
  WHO22_RS17265 pdeH 3257551..3258780 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO22_RS17270 pncB 3258917..3260389 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHO22_RS17275 pncA 3260405..3260956 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHO22_RS17280 yueI 3261053..3261451 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=951254 WHO22_RS17250 WP_003220708.1 3256606..3256746(-) (degQ) [Bacillus subtilis isolate FELIX_MS513]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=951254 WHO22_RS17250 WP_003220708.1 3256606..3256746(-) (degQ) [Bacillus subtilis isolate FELIX_MS513]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1