Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   WHO22_RS17240 Genome accession   NZ_CP148122
Coordinates   3255367..3255534 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis isolate FELIX_MS513     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3250367..3260534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO22_RS17210 mrpE 3250762..3251238 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WHO22_RS17215 mrpF 3251238..3251522 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WHO22_RS17220 mnhG 3251506..3251880 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WHO22_RS17225 yuxO 3251919..3252299 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO22_RS17230 comA 3252318..3252962 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO22_RS17235 comP 3253043..3255352 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  WHO22_RS17240 comX 3255367..3255534 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO22_RS17245 comQ 3255522..3256421 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO22_RS17250 degQ 3256606..3256746 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO22_RS17255 - 3256968..3257093 (+) 126 WP_003228793.1 hypothetical protein -
  WHO22_RS17260 - 3257207..3257575 (+) 369 WP_003243784.1 hypothetical protein -
  WHO22_RS17265 pdeH 3257551..3258780 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO22_RS17270 pncB 3258917..3260389 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=951252 WHO22_RS17240 WP_003242801.1 3255367..3255534(-) (comX) [Bacillus subtilis isolate FELIX_MS513]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=951252 WHO22_RS17240 WP_003242801.1 3255367..3255534(-) (comX) [Bacillus subtilis isolate FELIX_MS513]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1