Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   WHO59_RS13345 Genome accession   NZ_CP148120
Coordinates   2551711..2551884 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate FELIX_MS512     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2546711..2556884
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO59_RS13330 gcvT 2547510..2548598 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WHO59_RS13335 yqhH 2549040..2550713 (+) 1674 WP_004398544.1 SNF2-related protein -
  WHO59_RS13340 yqhG 2550734..2551528 (+) 795 WP_003230200.1 YqhG family protein -
  WHO59_RS13345 sinI 2551711..2551884 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHO59_RS13350 sinR 2551918..2552253 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHO59_RS13355 tasA 2552346..2553131 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHO59_RS13360 sipW 2553195..2553767 (-) 573 WP_003246088.1 signal peptidase I -
  WHO59_RS13365 tapA 2553751..2554512 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHO59_RS13370 yqzG 2554784..2555110 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHO59_RS13375 spoIIT 2555152..2555331 (-) 180 WP_003230176.1 YqzE family protein -
  WHO59_RS13380 comGG 2555402..2555776 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHO59_RS13385 comGF 2555777..2556160 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHO59_RS13390 comGE 2556186..2556533 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=951142 WHO59_RS13345 WP_003230187.1 2551711..2551884(+) (sinI) [Bacillus subtilis isolate FELIX_MS512]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=951142 WHO59_RS13345 WP_003230187.1 2551711..2551884(+) (sinI) [Bacillus subtilis isolate FELIX_MS512]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1