Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WHL98_RS13360 Genome accession   NZ_CP148104
Coordinates   2553297..2553470 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS438     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2548297..2558470
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL98_RS13345 gcvT 2549096..2550184 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WHL98_RS13350 yqhH 2550626..2552299 (+) 1674 WP_004398544.1 SNF2-related protein -
  WHL98_RS13355 yqhG 2552320..2553114 (+) 795 WP_003230200.1 YqhG family protein -
  WHL98_RS13360 sinI 2553297..2553470 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHL98_RS13365 sinR 2553504..2553839 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHL98_RS13370 tasA 2553932..2554717 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHL98_RS13375 sipW 2554781..2555353 (-) 573 WP_003246088.1 signal peptidase I -
  WHL98_RS13380 tapA 2555337..2556098 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHL98_RS13385 yqzG 2556370..2556696 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHL98_RS13390 spoIIT 2556738..2556917 (-) 180 WP_003230176.1 YqzE family protein -
  WHL98_RS13395 comGG 2556988..2557362 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHL98_RS13400 comGF 2557363..2557746 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHL98_RS13405 comGE 2557772..2558119 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=950601 WHL98_RS13360 WP_003230187.1 2553297..2553470(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=950601 WHL98_RS13360 WP_003230187.1 2553297..2553470(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1