Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | WHL98_RS13360 | Genome accession | NZ_CP148104 |
| Coordinates | 2553297..2553470 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis isolate FELIX_MS438 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2548297..2558470
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WHL98_RS13345 | gcvT | 2549096..2550184 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WHL98_RS13350 | yqhH | 2550626..2552299 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| WHL98_RS13355 | yqhG | 2552320..2553114 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| WHL98_RS13360 | sinI | 2553297..2553470 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| WHL98_RS13365 | sinR | 2553504..2553839 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| WHL98_RS13370 | tasA | 2553932..2554717 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| WHL98_RS13375 | sipW | 2554781..2555353 (-) | 573 | WP_003246088.1 | signal peptidase I | - |
| WHL98_RS13380 | tapA | 2555337..2556098 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| WHL98_RS13385 | yqzG | 2556370..2556696 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| WHL98_RS13390 | spoIIT | 2556738..2556917 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| WHL98_RS13395 | comGG | 2556988..2557362 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| WHL98_RS13400 | comGF | 2557363..2557746 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| WHL98_RS13405 | comGE | 2557772..2558119 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=950601 WHL98_RS13360 WP_003230187.1 2553297..2553470(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=950601 WHL98_RS13360 WP_003230187.1 2553297..2553470(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |