Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WHL98_RS13400 Genome accession   NZ_CP148104
Coordinates   2557363..2557746 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS438     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2552363..2562746
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL98_RS13360 sinI 2553297..2553470 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHL98_RS13365 sinR 2553504..2553839 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHL98_RS13370 tasA 2553932..2554717 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHL98_RS13375 sipW 2554781..2555353 (-) 573 WP_003246088.1 signal peptidase I -
  WHL98_RS13380 tapA 2555337..2556098 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHL98_RS13385 yqzG 2556370..2556696 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHL98_RS13390 spoIIT 2556738..2556917 (-) 180 WP_003230176.1 YqzE family protein -
  WHL98_RS13395 comGG 2556988..2557362 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHL98_RS13400 comGF 2557363..2557746 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHL98_RS13405 comGE 2557772..2558119 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  WHL98_RS13410 comGD 2558103..2558534 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  WHL98_RS13415 comGC 2558524..2558820 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  WHL98_RS13420 comGB 2558834..2559871 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  WHL98_RS13425 comGA 2559858..2560928 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WHL98_RS13430 corA 2561340..2562293 (-) 954 WP_032723504.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=950604 WHL98_RS13400 WP_003230168.1 2557363..2557746(-) (comGF) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=950604 WHL98_RS13400 WP_003230168.1 2557363..2557746(-) (comGF) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1