Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WHL49_RS16070 Genome accession   NZ_CP148103
Coordinates   3098462..3098602 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS361     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3093462..3103602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL49_RS16045 yuxO 3093775..3094155 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHL49_RS16050 comA 3094174..3094818 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHL49_RS16055 comP 3094899..3097208 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  WHL49_RS16060 comX 3097223..3097390 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHL49_RS16065 comQ 3097378..3098277 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHL49_RS16070 degQ 3098462..3098602 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHL49_RS16075 - 3098824..3098949 (+) 126 WP_003228793.1 hypothetical protein -
  WHL49_RS16080 - 3099063..3099431 (+) 369 WP_003243784.1 hypothetical protein -
  WHL49_RS16085 pdeH 3099407..3100636 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHL49_RS16090 pncB 3100773..3102245 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHL49_RS16095 pncA 3102261..3102812 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHL49_RS16100 yueI 3102909..3103307 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=950541 WHL49_RS16070 WP_003220708.1 3098462..3098602(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=950541 WHL49_RS16070 WP_003220708.1 3098462..3098602(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1