Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   WHL49_RS16060 Genome accession   NZ_CP148103
Coordinates   3097223..3097390 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS361     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3092223..3102390
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL49_RS16030 mrpE 3092618..3093094 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WHL49_RS16035 mrpF 3093094..3093378 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WHL49_RS16040 mnhG 3093362..3093736 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WHL49_RS16045 yuxO 3093775..3094155 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHL49_RS16050 comA 3094174..3094818 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHL49_RS16055 comP 3094899..3097208 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  WHL49_RS16060 comX 3097223..3097390 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHL49_RS16065 comQ 3097378..3098277 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHL49_RS16070 degQ 3098462..3098602 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHL49_RS16075 - 3098824..3098949 (+) 126 WP_003228793.1 hypothetical protein -
  WHL49_RS16080 - 3099063..3099431 (+) 369 WP_003243784.1 hypothetical protein -
  WHL49_RS16085 pdeH 3099407..3100636 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHL49_RS16090 pncB 3100773..3102245 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=950539 WHL49_RS16060 WP_003242801.1 3097223..3097390(-) (comX) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=950539 WHL49_RS16060 WP_003242801.1 3097223..3097390(-) (comX) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1