Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   WHL49_RS12195 Genome accession   NZ_CP148103
Coordinates   2393815..2393988 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS361     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2388815..2398988
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL49_RS12180 gcvT 2389614..2390702 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WHL49_RS12185 yqhH 2391144..2392817 (+) 1674 WP_004398544.1 SNF2-related protein -
  WHL49_RS12190 yqhG 2392838..2393632 (+) 795 WP_003230200.1 YqhG family protein -
  WHL49_RS12195 sinI 2393815..2393988 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHL49_RS12200 sinR 2394022..2394357 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHL49_RS12205 tasA 2394450..2395235 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHL49_RS12210 sipW 2395299..2395871 (-) 573 WP_003246088.1 signal peptidase I -
  WHL49_RS12215 tapA 2395855..2396616 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHL49_RS12220 yqzG 2396888..2397214 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHL49_RS12225 spoIIT 2397256..2397435 (-) 180 WP_003230176.1 YqzE family protein -
  WHL49_RS12230 comGG 2397506..2397880 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHL49_RS12235 comGF 2397881..2398264 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHL49_RS12240 comGE 2398290..2398637 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=950515 WHL49_RS12195 WP_003230187.1 2393815..2393988(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=950515 WHL49_RS12195 WP_003230187.1 2393815..2393988(+) (sinI) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1