Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WHL49_RS12235 Genome accession   NZ_CP148103
Coordinates   2397881..2398264 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS361     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2392881..2403264
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL49_RS12195 sinI 2393815..2393988 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHL49_RS12200 sinR 2394022..2394357 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHL49_RS12205 tasA 2394450..2395235 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHL49_RS12210 sipW 2395299..2395871 (-) 573 WP_003246088.1 signal peptidase I -
  WHL49_RS12215 tapA 2395855..2396616 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHL49_RS12220 yqzG 2396888..2397214 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHL49_RS12225 spoIIT 2397256..2397435 (-) 180 WP_003230176.1 YqzE family protein -
  WHL49_RS12230 comGG 2397506..2397880 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHL49_RS12235 comGF 2397881..2398264 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHL49_RS12240 comGE 2398290..2398637 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  WHL49_RS12245 comGD 2398621..2399052 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  WHL49_RS12250 comGC 2399042..2399338 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  WHL49_RS12255 comGB 2399352..2400389 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  WHL49_RS12260 comGA 2400376..2401446 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WHL49_RS12265 corA 2401858..2402811 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=950518 WHL49_RS12235 WP_003230168.1 2397881..2398264(-) (comGF) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=950518 WHL49_RS12235 WP_003230168.1 2397881..2398264(-) (comGF) [Bacillus subtilis subsp. subtilis isolate FELIX_MS361]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1