Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WHL51_RS12345 Genome accession   NZ_CP148102
Coordinates   2419655..2420038 (-) Length   127 a.a.
NCBI ID   WP_032727308.1    Uniprot ID   -
Organism   Bacillus spizizenii str. W23     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2414655..2425038
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL51_RS12305 sinI 2415590..2415763 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  WHL51_RS12310 sinR 2415797..2416132 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHL51_RS12315 tasA 2416226..2417011 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  WHL51_RS12320 sipW 2417075..2417647 (-) 573 WP_003226338.1 signal peptidase I SipW -
  WHL51_RS12325 tapA 2417631..2418392 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  WHL51_RS12330 - 2418661..2418987 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  WHL51_RS12335 - 2419029..2419208 (-) 180 WP_003226330.1 YqzE family protein -
  WHL51_RS12340 comGG 2419280..2419654 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  WHL51_RS12345 comGF 2419655..2420038 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  WHL51_RS12350 comGE 2420064..2420411 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  WHL51_RS12355 comGD 2420395..2420826 (-) 432 WP_003226321.1 competence type IV pilus minor pilin ComGD Machinery gene
  WHL51_RS12360 comGC 2420816..2421112 (-) 297 WP_003226319.1 comG operon protein ComGC Machinery gene
  WHL51_RS12365 comGB 2421126..2422163 (-) 1038 WP_003226315.1 competence type IV pilus assembly protein ComGB Machinery gene
  WHL51_RS12370 comGA 2422150..2423220 (-) 1071 WP_003226312.1 competence protein ComGA Machinery gene
  WHL51_RS12375 - 2423433..2423843 (-) 411 WP_032727412.1 CBS domain-containing protein -
  WHL51_RS12380 - 2423906..2424859 (-) 954 WP_003226308.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14414.59 Da        Isoelectric Point: 6.9668

>NTDB_id=950434 WHL51_RS12345 WP_032727308.1 2419655..2420038(-) (comGF) [Bacillus spizizenii str. W23]
MLISGSLAMIFHLFLSRQQEYEGFTQQEWLISMEQMMNECKQSHAVKTAEHGSVLICTNPSGQDIRFEIYHSMIRKRVDG
KGHVPILDNITAMRADIENGVVLLKIKSENQKVYQTAFSVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=950434 WHL51_RS12345 WP_032727308.1 2419655..2420038(-) (comGF) [Bacillus spizizenii str. W23]
TTGCTCATATCAGGATCGTTAGCTATGATCTTCCATTTGTTTTTGTCACGGCAGCAGGAATATGAGGGTTTCACACAGCA
AGAATGGTTGATTTCGATGGAACAGATGATGAACGAATGCAAGCAGTCACACGCAGTCAAGACAGCCGAACATGGGAGCG
TGTTGATCTGTACCAATCCTTCTGGGCAAGATATACGTTTTGAAATCTATCATTCCATGATAAGAAAAAGGGTAGATGGC
AAAGGGCATGTTCCGATTCTAGATAATATTACAGCCATGAGAGCCGATATTGAAAATGGTGTTGTTTTACTGAAAATTAA
GAGTGAGAACCAAAAAGTGTATCAAACTGCTTTTTCGGTTTATTCGTATTTAGGAGGAGGGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

88.189

100

0.882