Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | WHL51_RS12305 | Genome accession | NZ_CP148102 |
| Coordinates | 2415590..2415763 (+) | Length | 57 a.a. |
| NCBI ID | WP_003226347.1 | Uniprot ID | G4NQ83 |
| Organism | Bacillus spizizenii str. W23 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2410590..2420763
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WHL51_RS12290 | gcvT | 2411385..2412473 (-) | 1089 | WP_003226353.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WHL51_RS12295 | - | 2412916..2414589 (+) | 1674 | WP_003226350.1 | DEAD/DEAH box helicase | - |
| WHL51_RS12300 | - | 2414610..2415404 (+) | 795 | WP_003226349.1 | YqhG family protein | - |
| WHL51_RS12305 | sinI | 2415590..2415763 (+) | 174 | WP_003226347.1 | anti-repressor SinI | Regulator |
| WHL51_RS12310 | sinR | 2415797..2416132 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| WHL51_RS12315 | tasA | 2416226..2417011 (-) | 786 | WP_003226340.1 | biofilm matrix protein TasA | - |
| WHL51_RS12320 | sipW | 2417075..2417647 (-) | 573 | WP_003226338.1 | signal peptidase I SipW | - |
| WHL51_RS12325 | tapA | 2417631..2418392 (-) | 762 | WP_003226335.1 | amyloid fiber anchoring/assembly protein TapA | - |
| WHL51_RS12330 | - | 2418661..2418987 (+) | 327 | WP_079996407.1 | YqzG/YhdC family protein | - |
| WHL51_RS12335 | - | 2419029..2419208 (-) | 180 | WP_003226330.1 | YqzE family protein | - |
| WHL51_RS12340 | comGG | 2419280..2419654 (-) | 375 | WP_003226328.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| WHL51_RS12345 | comGF | 2419655..2420038 (-) | 384 | WP_032727308.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| WHL51_RS12350 | comGE | 2420064..2420411 (-) | 348 | WP_003226323.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6632.64 Da Isoelectric Point: 8.6596
>NTDB_id=950431 WHL51_RS12305 WP_003226347.1 2415590..2415763(+) (sinI) [Bacillus spizizenii str. W23]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=950431 WHL51_RS12305 WP_003226347.1 2415590..2415763(+) (sinI) [Bacillus spizizenii str. W23]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
96.491 |
100 |
0.965 |