Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   WHL51_RS12305 Genome accession   NZ_CP148102
Coordinates   2415590..2415763 (+) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus spizizenii str. W23     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2410590..2420763
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL51_RS12290 gcvT 2411385..2412473 (-) 1089 WP_003226353.1 glycine cleavage system aminomethyltransferase GcvT -
  WHL51_RS12295 - 2412916..2414589 (+) 1674 WP_003226350.1 DEAD/DEAH box helicase -
  WHL51_RS12300 - 2414610..2415404 (+) 795 WP_003226349.1 YqhG family protein -
  WHL51_RS12305 sinI 2415590..2415763 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  WHL51_RS12310 sinR 2415797..2416132 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHL51_RS12315 tasA 2416226..2417011 (-) 786 WP_003226340.1 biofilm matrix protein TasA -
  WHL51_RS12320 sipW 2417075..2417647 (-) 573 WP_003226338.1 signal peptidase I SipW -
  WHL51_RS12325 tapA 2417631..2418392 (-) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  WHL51_RS12330 - 2418661..2418987 (+) 327 WP_079996407.1 YqzG/YhdC family protein -
  WHL51_RS12335 - 2419029..2419208 (-) 180 WP_003226330.1 YqzE family protein -
  WHL51_RS12340 comGG 2419280..2419654 (-) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  WHL51_RS12345 comGF 2419655..2420038 (-) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  WHL51_RS12350 comGE 2420064..2420411 (-) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=950431 WHL51_RS12305 WP_003226347.1 2415590..2415763(+) (sinI) [Bacillus spizizenii str. W23]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=950431 WHL51_RS12305 WP_003226347.1 2415590..2415763(+) (sinI) [Bacillus spizizenii str. W23]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965