Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   V7S31_RS13060 Genome accession   NZ_CP147655
Coordinates   2710198..2710371 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain M1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2705198..2715371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V7S31_RS13045 gcvT 2706011..2707111 (-) 1101 WP_039063314.1 glycine cleavage system aminomethyltransferase GcvT -
  V7S31_RS13050 - 2707535..2709205 (+) 1671 WP_007408331.1 SNF2-related protein -
  V7S31_RS13055 - 2709227..2710021 (+) 795 WP_007408330.1 YqhG family protein -
  V7S31_RS13060 sinI 2710198..2710371 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  V7S31_RS13065 sinR 2710405..2710740 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V7S31_RS13070 - 2710788..2711573 (-) 786 WP_007408329.1 TasA family protein -
  V7S31_RS13075 - 2711638..2712222 (-) 585 WP_007408328.1 signal peptidase I -
  V7S31_RS13080 tapA 2712194..2712865 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  V7S31_RS13085 - 2713124..2713453 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  V7S31_RS13090 - 2713493..2713672 (-) 180 WP_003153093.1 YqzE family protein -
  V7S31_RS13095 comGG 2713729..2714106 (-) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  V7S31_RS13100 comGF 2714107..2714607 (-) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  V7S31_RS13105 comGE 2714516..2714830 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  V7S31_RS13110 comGD 2714814..2715251 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=947869 V7S31_RS13060 WP_003153105.1 2710198..2710371(+) (sinI) [Bacillus velezensis strain M1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=947869 V7S31_RS13060 WP_003153105.1 2710198..2710371(+) (sinI) [Bacillus velezensis strain M1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702