Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WBI56_RS12440 Genome accession   NZ_CP147492
Coordinates   2421783..2422166 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   A0AA96UKP5
Organism   Bacillus subtilis strain MC4-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2416783..2427166
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WBI56_RS12400 (WBI56_12400) sinI 2417716..2417889 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WBI56_RS12405 (WBI56_12405) sinR 2417923..2418258 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WBI56_RS12410 (WBI56_12410) tasA 2418351..2419136 (-) 786 WP_072175550.1 biofilm matrix protein TasA -
  WBI56_RS12415 (WBI56_12415) sipW 2419200..2419772 (-) 573 WP_003230181.1 signal peptidase I -
  WBI56_RS12420 (WBI56_12420) tapA 2419756..2420517 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  WBI56_RS12425 (WBI56_12425) yqzG 2420789..2421115 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WBI56_RS12430 (WBI56_12430) spoIIT 2421157..2421336 (-) 180 WP_029726723.1 YqzE family protein -
  WBI56_RS12435 (WBI56_12435) comGG 2421408..2421782 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  WBI56_RS12440 (WBI56_12440) comGF 2421783..2422166 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  WBI56_RS12445 (WBI56_12445) comGE 2422192..2422539 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  WBI56_RS12450 (WBI56_12450) comGD 2422523..2422954 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  WBI56_RS12455 (WBI56_12455) comGC 2422944..2423240 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  WBI56_RS12460 (WBI56_12460) comGB 2423254..2424291 (-) 1038 WP_338730579.1 comG operon protein ComGB Machinery gene
  WBI56_RS12465 (WBI56_12465) comGA 2424278..2425348 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  WBI56_RS12470 (WBI56_12470) corA 2425760..2426713 (-) 954 WP_338730580.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=946347 WBI56_RS12440 WP_046160582.1 2421783..2422166(-) (comGF) [Bacillus subtilis strain MC4-2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=946347 WBI56_RS12440 WP_046160582.1 2421783..2422166(-) (comGF) [Bacillus subtilis strain MC4-2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984