Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   WBI56_RS12400 Genome accession   NZ_CP147492
Coordinates   2417716..2417889 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain MC4-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2412716..2422889
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WBI56_RS12385 (WBI56_12385) gcvT 2413516..2414604 (-) 1089 WP_338730576.1 glycine cleavage system aminomethyltransferase GcvT -
  WBI56_RS12390 (WBI56_12390) yqhH 2415045..2416718 (+) 1674 WP_338730578.1 SNF2-related protein -
  WBI56_RS12395 (WBI56_12395) yqhG 2416739..2417533 (+) 795 WP_003230200.1 YqhG family protein -
  WBI56_RS12400 (WBI56_12400) sinI 2417716..2417889 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WBI56_RS12405 (WBI56_12405) sinR 2417923..2418258 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WBI56_RS12410 (WBI56_12410) tasA 2418351..2419136 (-) 786 WP_072175550.1 biofilm matrix protein TasA -
  WBI56_RS12415 (WBI56_12415) sipW 2419200..2419772 (-) 573 WP_003230181.1 signal peptidase I -
  WBI56_RS12420 (WBI56_12420) tapA 2419756..2420517 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  WBI56_RS12425 (WBI56_12425) yqzG 2420789..2421115 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WBI56_RS12430 (WBI56_12430) spoIIT 2421157..2421336 (-) 180 WP_029726723.1 YqzE family protein -
  WBI56_RS12435 (WBI56_12435) comGG 2421408..2421782 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  WBI56_RS12440 (WBI56_12440) comGF 2421783..2422166 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  WBI56_RS12445 (WBI56_12445) comGE 2422192..2422539 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=946344 WBI56_RS12400 WP_003230187.1 2417716..2417889(+) (sinI) [Bacillus subtilis strain MC4-2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=946344 WBI56_RS12400 WP_003230187.1 2417716..2417889(+) (sinI) [Bacillus subtilis strain MC4-2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1