Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACFXAC_RS11805 Genome accession   NZ_CP170720
Coordinates   2466139..2466576 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   A7Z6N7
Organism   Bacillus amyloliquefaciens strain JP5006     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2461139..2471576
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAC_RS11755 (ACFXAC_11755) sinI 2461523..2461696 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACFXAC_RS11760 (ACFXAC_11760) sinR 2461730..2462065 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFXAC_RS11765 (ACFXAC_11765) tasA 2462113..2462898 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFXAC_RS11770 (ACFXAC_11770) sipW 2462963..2463547 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACFXAC_RS11775 (ACFXAC_11775) tapA 2463519..2464190 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  ACFXAC_RS11780 (ACFXAC_11780) - 2464449..2464778 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  ACFXAC_RS11785 (ACFXAC_11785) - 2464818..2464997 (-) 180 WP_003153093.1 YqzE family protein -
  ACFXAC_RS11790 (ACFXAC_11790) comGG 2465054..2465431 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFXAC_RS11795 (ACFXAC_11795) comGF 2465432..2465932 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  ACFXAC_RS11800 (ACFXAC_11800) comGE 2465841..2466155 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFXAC_RS11805 (ACFXAC_11805) comGD 2466139..2466576 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFXAC_RS11810 (ACFXAC_11810) comGC 2466566..2466874 (-) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  ACFXAC_RS11815 (ACFXAC_11815) comGB 2466879..2467916 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACFXAC_RS11820 (ACFXAC_11820) comGA 2467903..2468973 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  ACFXAC_RS11825 (ACFXAC_11825) - 2469166..2470116 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  ACFXAC_RS11830 (ACFXAC_11830) - 2470262..2471563 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=945358 ACFXAC_RS11805 WP_012117983.1 2466139..2466576(-) (comGD) [Bacillus amyloliquefaciens strain JP5006]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=945358 ACFXAC_RS11805 WP_012117983.1 2466139..2466576(-) (comGD) [Bacillus amyloliquefaciens strain JP5006]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6N7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572