Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFXAD_RS08775 Genome accession   NZ_CP170653
Coordinates   1700872..1701045 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain JP5011     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1695872..1706045
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAD_RS08725 (ACFXAD_08725) comGD 1695992..1696429 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFXAD_RS08730 (ACFXAD_08730) comGE 1696413..1696727 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFXAD_RS08735 (ACFXAD_08735) comGF 1696636..1697136 (+) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  ACFXAD_RS08740 (ACFXAD_08740) comGG 1697137..1697514 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFXAD_RS08745 (ACFXAD_08745) - 1697571..1697750 (+) 180 WP_003153093.1 YqzE family protein -
  ACFXAD_RS08750 (ACFXAD_08750) - 1697790..1698119 (-) 330 WP_039254490.1 DUF3889 domain-containing protein -
  ACFXAD_RS08755 (ACFXAD_08755) tapA 1698378..1699049 (+) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  ACFXAD_RS08760 (ACFXAD_08760) sipW 1699021..1699605 (+) 585 WP_015240205.1 signal peptidase I SipW -
  ACFXAD_RS08765 (ACFXAD_08765) tasA 1699670..1700455 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFXAD_RS08770 (ACFXAD_08770) sinR 1700503..1700838 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFXAD_RS08775 (ACFXAD_08775) sinI 1700872..1701045 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACFXAD_RS08780 (ACFXAD_08780) - 1701222..1702016 (-) 795 WP_007408330.1 YqhG family protein -
  ACFXAD_RS08785 (ACFXAD_08785) - 1702038..1703708 (-) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  ACFXAD_RS08790 (ACFXAD_08790) gcvT 1704132..1705232 (+) 1101 WP_053573200.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=944890 ACFXAD_RS08775 WP_003153105.1 1700872..1701045(-) (sinI) [Bacillus amyloliquefaciens strain JP5011]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=944890 ACFXAD_RS08775 WP_003153105.1 1700872..1701045(-) (sinI) [Bacillus amyloliquefaciens strain JP5011]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702