Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACFXAD_RS08730 Genome accession   NZ_CP170653
Coordinates   1696413..1696727 (+) Length   104 a.a.
NCBI ID   WP_012117982.1    Uniprot ID   A7Z6N6
Organism   Bacillus amyloliquefaciens strain JP5011     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1691413..1701727
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAD_RS08705 (ACFXAD_08705) - 1692452..1693402 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  ACFXAD_RS08710 (ACFXAD_08710) comGA 1693595..1694665 (+) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  ACFXAD_RS08715 (ACFXAD_08715) comGB 1694652..1695689 (+) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACFXAD_RS08720 (ACFXAD_08720) comGC 1695694..1696002 (+) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  ACFXAD_RS08725 (ACFXAD_08725) comGD 1695992..1696429 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFXAD_RS08730 (ACFXAD_08730) comGE 1696413..1696727 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFXAD_RS08735 (ACFXAD_08735) comGF 1696636..1697136 (+) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  ACFXAD_RS08740 (ACFXAD_08740) comGG 1697137..1697514 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFXAD_RS08745 (ACFXAD_08745) - 1697571..1697750 (+) 180 WP_003153093.1 YqzE family protein -
  ACFXAD_RS08750 (ACFXAD_08750) - 1697790..1698119 (-) 330 WP_039254490.1 DUF3889 domain-containing protein -
  ACFXAD_RS08755 (ACFXAD_08755) tapA 1698378..1699049 (+) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  ACFXAD_RS08760 (ACFXAD_08760) sipW 1699021..1699605 (+) 585 WP_015240205.1 signal peptidase I SipW -
  ACFXAD_RS08765 (ACFXAD_08765) tasA 1699670..1700455 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFXAD_RS08770 (ACFXAD_08770) sinR 1700503..1700838 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFXAD_RS08775 (ACFXAD_08775) sinI 1700872..1701045 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11904.90 Da        Isoelectric Point: 6.9470

>NTDB_id=944887 ACFXAD_RS08730 WP_012117982.1 1696413..1696727(+) (comGE) [Bacillus amyloliquefaciens strain JP5011]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCTADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=944887 ACFXAD_RS08730 WP_012117982.1 1696413..1696727(+) (comGE) [Bacillus amyloliquefaciens strain JP5011]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTACGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6N6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

42.609

100

0.471