Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   V9W58_RS13615 Genome accession   NZ_CP146764
Coordinates   2727699..2728076 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain AP202     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2722699..2733076
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W58_RS13575 (V9W58_13575) - 2723198..2723992 (+) 795 WP_076424968.1 YqhG family protein -
  V9W58_RS13580 (V9W58_13580) sinI 2724169..2724342 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  V9W58_RS13585 (V9W58_13585) sinR 2724376..2724711 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V9W58_RS13590 (V9W58_13590) - 2724759..2725544 (-) 786 WP_076424970.1 TasA family protein -
  V9W58_RS13595 (V9W58_13595) - 2725609..2726193 (-) 585 WP_015240205.1 signal peptidase I -
  V9W58_RS13600 (V9W58_13600) tapA 2726165..2726836 (-) 672 WP_076424972.1 amyloid fiber anchoring/assembly protein TapA -
  V9W58_RS13605 (V9W58_13605) - 2727095..2727424 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  V9W58_RS13610 (V9W58_13610) - 2727463..2727642 (-) 180 WP_003153093.1 YqzE family protein -
  V9W58_RS13615 (V9W58_13615) comGG 2727699..2728076 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  V9W58_RS13620 (V9W58_13620) comGF 2728077..2728577 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  V9W58_RS13625 (V9W58_13625) comGE 2728486..2728800 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  V9W58_RS13630 (V9W58_13630) comGD 2728784..2729221 (-) 438 WP_251248306.1 competence type IV pilus minor pilin ComGD Machinery gene
  V9W58_RS13635 (V9W58_13635) comGC 2729211..2729519 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V9W58_RS13640 (V9W58_13640) comGB 2729524..2730561 (-) 1038 WP_285865297.1 competence type IV pilus assembly protein ComGB Machinery gene
  V9W58_RS13645 (V9W58_13645) comGA 2730548..2731618 (-) 1071 WP_251248305.1 competence type IV pilus ATPase ComGA Machinery gene
  V9W58_RS13650 (V9W58_13650) - 2731810..2732760 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=944587 V9W58_RS13615 WP_012117980.1 2727699..2728076(-) (comGG) [Bacillus velezensis strain AP202]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=944587 V9W58_RS13615 WP_012117980.1 2727699..2728076(-) (comGG) [Bacillus velezensis strain AP202]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512