Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   V9W58_RS02015 Genome accession   NZ_CP146764
Coordinates   396822..396941 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus velezensis strain AP202     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 391822..401941
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W58_RS02000 (V9W58_02000) - 393434..394117 (+) 684 WP_160242544.1 response regulator transcription factor -
  V9W58_RS02005 (V9W58_02005) - 394104..395537 (+) 1434 WP_165913860.1 HAMP domain-containing sensor histidine kinase -
  V9W58_RS02010 (V9W58_02010) rapC 395690..396838 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  V9W58_RS02015 (V9W58_02015) phrC 396822..396941 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  V9W58_RS02020 (V9W58_02020) - 397090..397185 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  V9W58_RS02025 (V9W58_02025) - 397280..398644 (-) 1365 WP_251248582.1 aspartate kinase -
  V9W58_RS02030 (V9W58_02030) ceuB 399058..400011 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  V9W58_RS02035 (V9W58_02035) - 400001..400948 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  V9W58_RS02040 (V9W58_02040) - 400942..401700 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=944554 V9W58_RS02015 WP_033575081.1 396822..396941(+) (phrC) [Bacillus velezensis strain AP202]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=944554 V9W58_RS02015 WP_033575081.1 396822..396941(+) (phrC) [Bacillus velezensis strain AP202]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744