Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   V9W62_RS01985 Genome accession   NZ_CP146763
Coordinates   392217..392336 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus velezensis strain AP81     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 387217..397336
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W62_RS01970 (V9W62_01970) - 388829..389512 (+) 684 WP_007410267.1 response regulator transcription factor -
  V9W62_RS01975 (V9W62_01975) - 389499..390926 (+) 1428 WP_162533087.1 HAMP domain-containing sensor histidine kinase -
  V9W62_RS01980 (V9W62_01980) rapC 391085..392233 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  V9W62_RS01985 (V9W62_01985) phrC 392217..392336 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  V9W62_RS01990 (V9W62_01990) - 392484..392579 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  V9W62_RS01995 (V9W62_01995) - 392674..394038 (-) 1365 WP_043021400.1 aspartate kinase -
  V9W62_RS02000 (V9W62_02000) ceuB 394452..395405 (+) 954 WP_012116802.1 ABC transporter permease Machinery gene
  V9W62_RS02005 (V9W62_02005) - 395395..396342 (+) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  V9W62_RS02010 (V9W62_02010) - 396336..397094 (+) 759 WP_043021401.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=944479 V9W62_RS01985 WP_033575081.1 392217..392336(+) (phrC) [Bacillus velezensis strain AP81]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=944479 V9W62_RS01985 WP_033575081.1 392217..392336(+) (phrC) [Bacillus velezensis strain AP81]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744