Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V6986_RS14550 Genome accession   NZ_CP146358
Coordinates   2847940..2848080 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis strain yw6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2842940..2853080
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6986_RS14525 (V6986_14525) - 2843205..2843594 (-) 390 WP_039181120.1 hotdog fold thioesterase -
  V6986_RS14530 (V6986_14530) comA 2843618..2844259 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  V6986_RS14535 (V6986_14535) comP 2844340..2846652 (-) 2313 WP_338592498.1 ATP-binding protein Regulator
  V6986_RS14540 (V6986_14540) comX 2846707..2846877 (-) 171 WP_181286101.1 competence pheromone ComX -
  V6986_RS14545 (V6986_14545) - 2846874..2847788 (-) 915 WP_338592503.1 polyprenyl synthetase family protein -
  V6986_RS14550 (V6986_14550) degQ 2847940..2848080 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  V6986_RS14555 (V6986_14555) - 2848586..2848942 (+) 357 WP_338592509.1 inner spore coat protein -
  V6986_RS14560 (V6986_14560) - 2848978..2850204 (-) 1227 WP_047203313.1 HDOD domain-containing protein -
  V6986_RS14565 (V6986_14565) - 2850342..2851814 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  V6986_RS14570 (V6986_14570) - 2851832..2852383 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  V6986_RS14575 (V6986_14575) - 2852444..2852851 (-) 408 WP_268465247.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=942756 V6986_RS14550 WP_003213123.1 2847940..2848080(-) (degQ) [Bacillus safensis strain yw6]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=942756 V6986_RS14550 WP_003213123.1 2847940..2848080(-) (degQ) [Bacillus safensis strain yw6]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696