Detailed information    

insolico Bioinformatically predicted

Overview

Name   amiD   Type   Regulator
Locus tag   V6K67_RS08195 Genome accession   NZ_CP145941
Coordinates   1583337..1584263 (-) Length   308 a.a.
NCBI ID   WP_002946409.1    Uniprot ID   -
Organism   Streptococcus thermophilus strain TCI633     
Function   internalize XIP (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1565784..1637561 1583337..1584263 within 0


Gene organization within MGE regions


Location: 1565784..1637561
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6K67_RS08110 (V6K67_08110) liaF 1565792..1566490 (-) 699 WP_011226289.1 cell wall-active antibiotics response protein LiaF -
  V6K67_RS08115 (V6K67_08115) - 1566745..1566912 (-) 168 WP_224103618.1 potassium channel family protein -
  V6K67_RS08120 (V6K67_08120) stkP/pknB 1567549..1569420 (-) 1872 WP_011226292.1 Stk1 family PASTA domain-containing Ser/Thr kinase Regulator
  V6K67_RS08125 (V6K67_08125) - 1569420..1570157 (-) 738 WP_002946881.1 Stp1/IreP family PP2C-type Ser/Thr phosphatase -
  V6K67_RS08130 (V6K67_08130) rsmB 1570201..1571523 (-) 1323 WP_014608533.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  V6K67_RS08135 (V6K67_08135) fmt 1571513..1572448 (-) 936 WP_002951411.1 methionyl-tRNA formyltransferase -
  V6K67_RS08140 (V6K67_08140) - 1572466..1574862 (-) 2397 WP_011227404.1 primosomal protein N' -
  V6K67_RS08145 (V6K67_08145) rpoZ 1575004..1575318 (-) 315 WP_002951415.1 DNA-directed RNA polymerase subunit omega -
  V6K67_RS08150 (V6K67_08150) gmk 1575340..1575969 (-) 630 WP_011226296.1 guanylate kinase -
  V6K67_RS08155 (V6K67_08155) ftsY 1576202..1577593 (-) 1392 WP_011226297.1 signal recognition particle-docking protein FtsY -
  V6K67_RS08160 (V6K67_08160) - 1577607..1578422 (-) 816 WP_156703494.1 Cof-type HAD-IIB family hydrolase -
  V6K67_RS08165 (V6K67_08165) - 1578415..1579209 (-) 795 WP_059257398.1 HAD family hydrolase -
  V6K67_RS08170 (V6K67_08170) - 1579393..1579770 (+) 378 WP_011226300.1 GntR family transcriptional regulator -
  V6K67_RS08175 (V6K67_08175) - 1579775..1580473 (+) 699 WP_011226301.1 ABC transporter ATP-binding protein -
  V6K67_RS08180 (V6K67_08180) - 1580485..1581270 (+) 786 WP_002951425.1 hypothetical protein -
  V6K67_RS08185 (V6K67_08185) amiF 1581320..1582249 (-) 930 WP_002951426.1 ATP-binding cassette domain-containing protein Regulator
  V6K67_RS08190 (V6K67_08190) amiE 1582242..1583327 (-) 1086 WP_011226304.1 ABC transporter ATP-binding protein Regulator
  V6K67_RS08195 (V6K67_08195) amiD 1583337..1584263 (-) 927 WP_002946409.1 oligopeptide ABC transporter permease OppC Regulator
  V6K67_RS08200 (V6K67_08200) amiC 1584263..1585756 (-) 1494 WP_011227407.1 ABC transporter permease Regulator
  V6K67_RS08205 (V6K67_08205) amiA 1585818..1587785 (-) 1968 WP_059257397.1 peptide ABC transporter substrate-binding protein Regulator
  V6K67_RS08210 (V6K67_08210) - 1588141..1589391 (+) 1251 Protein_1567 ISL3 family transposase -
  V6K67_RS08215 (V6K67_08215) - 1589436..1591405 (-) 1970 Protein_1568 peptide ABC transporter substrate-binding protein -
  V6K67_RS08220 (V6K67_08220) - 1591609..1591799 (-) 191 Protein_1569 IS3 family transposase -
  V6K67_RS08225 (V6K67_08225) - 1591793..1592194 (-) 402 Protein_1570 ABC transporter ATP-binding protein -
  V6K67_RS08230 (V6K67_08230) - 1592189..1592549 (-) 361 Protein_1571 TatD family hydrolase -
  V6K67_RS08235 (V6K67_08235) - 1592898..1594103 (+) 1206 WP_011227415.1 OFA family MFS transporter -
  V6K67_RS08240 (V6K67_08240) - 1594149..1595501 (-) 1353 Protein_1573 IS3 family transposase -
  V6K67_RS08245 (V6K67_08245) pta 1595587..1596570 (-) 984 WP_011227420.1 phosphate acetyltransferase -
  V6K67_RS08250 (V6K67_08250) - 1596584..1597480 (-) 897 WP_011226316.1 RluA family pseudouridine synthase -
  V6K67_RS08255 (V6K67_08255) - 1597477..1598313 (-) 837 WP_041827075.1 NAD kinase -
  V6K67_RS08260 (V6K67_08260) - 1598285..1598959 (-) 675 WP_002951443.1 GTP pyrophosphokinase family protein -
  V6K67_RS08265 (V6K67_08265) - 1599055..1599630 (+) 576 WP_002951444.1 CYTH domain-containing protein -
  V6K67_RS08270 (V6K67_08270) - 1599993..1600964 (+) 972 WP_002951446.1 ribose-phosphate diphosphokinase -
  V6K67_RS08275 (V6K67_08275) - 1600968..1602080 (+) 1113 WP_002948029.1 cysteine desulfurase family protein -
  V6K67_RS08280 (V6K67_08280) - 1602082..1602429 (+) 348 WP_002948028.1 DUF1831 domain-containing protein -
  V6K67_RS08285 (V6K67_08285) - 1602573..1603232 (+) 660 WP_041827076.1 redox-sensing transcriptional repressor Rex -
  V6K67_RS08290 (V6K67_08290) - 1603225..1603920 (+) 696 WP_011227423.1 gamma-glutamyl-gamma-aminobutyrate hydrolase family protein -
  V6K67_RS08295 (V6K67_08295) radC 1603973..1604659 (-) 687 WP_011227424.1 DNA repair protein RadC -
  V6K67_RS08300 (V6K67_08300) - 1604838..1606178 (-) 1341 WP_231108743.1 DUF2142 domain-containing protein -
  V6K67_RS08305 (V6K67_08305) - 1606327..1608072 (-) 1746 WP_011227426.1 rhamnan synthesis F family protein -
  V6K67_RS08310 (V6K67_08310) - 1608074..1609774 (-) 1701 WP_041827077.1 glycosyltransferase family 4 protein -
  V6K67_RS08315 (V6K67_08315) - 1609792..1610994 (-) 1203 WP_059257395.1 ABC transporter ATP-binding protein -
  V6K67_RS08320 (V6K67_08320) - 1610994..1611800 (-) 807 WP_011227429.1 ABC transporter permease -
  V6K67_RS08325 (V6K67_08325) - 1611800..1612741 (-) 942 WP_011227430.1 glycosyltransferase family 2 protein -
  V6K67_RS08330 (V6K67_08330) - 1612738..1613886 (-) 1149 WP_011227431.1 glycosyltransferase family 1 protein -
  V6K67_RS08335 (V6K67_08335) - 1614005..1614787 (-) 783 WP_011227432.1 glycosyltransferase family A protein -
  V6K67_RS08340 (V6K67_08340) - 1614788..1615120 (-) 333 WP_011227433.1 DUF2304 domain-containing protein -
  V6K67_RS08345 (V6K67_08345) - 1615126..1615815 (-) 690 WP_011227434.1 glycosyltransferase family 2 protein -
  V6K67_RS08350 (V6K67_08350) - 1615917..1616377 (-) 461 Protein_1595 glycosyltransferase family 2 protein -
  V6K67_RS08355 (V6K67_08355) - 1616442..1617428 (-) 987 WP_011227437.1 glycosyltransferase family 2 protein -
  V6K67_RS08360 (V6K67_08360) - 1617425..1618684 (-) 1260 WP_011227438.1 lipopolysaccharide biosynthesis protein -
  V6K67_RS08365 (V6K67_08365) rfbD 1618805..1619656 (-) 852 WP_014621820.1 dTDP-4-dehydrorhamnose reductase -
  V6K67_RS08370 (V6K67_08370) - 1619774..1620700 (-) 927 WP_011227439.1 glycosyltransferase family 2 protein -
  V6K67_RS08375 (V6K67_08375) - 1620710..1621045 (-) 336 WP_002891474.1 metal-sulfur cluster assembly factor -
  V6K67_RS08380 (V6K67_08380) rpoD 1621099..1622208 (-) 1110 WP_011227440.1 RNA polymerase sigma factor RpoD -
  V6K67_RS08385 (V6K67_08385) dnaG 1622212..1624023 (-) 1812 WP_011227441.1 DNA primase -
  V6K67_RS08390 (V6K67_08390) rpsU 1624394..1624570 (-) 177 WP_011226340.1 30S ribosomal protein S21 -
  V6K67_RS08395 (V6K67_08395) - 1624951..1625904 (+) 954 WP_041826943.1 IS30 family transposase -
  V6K67_RS08400 (V6K67_08400) - 1626010..1626804 (-) 795 WP_011227442.1 ABC transporter substrate-binding protein -
  V6K67_RS08405 (V6K67_08405) - 1626897..1628006 (-) 1110 WP_041828295.1 aminotransferase -
  V6K67_RS08410 (V6K67_08410) - 1628353..1629150 (-) 798 WP_059257394.1 transporter substrate-binding domain-containing protein -
  V6K67_RS08415 (V6K67_08415) - 1629147..1629977 (-) 831 WP_041828297.1 transporter substrate-binding domain-containing protein -
  V6K67_RS08420 (V6K67_08420) - 1630191..1630655 (-) 465 WP_011226345.1 8-oxo-dGTP diphosphatase -
  V6K67_RS08425 (V6K67_08425) uvrB 1630700..1632691 (-) 1992 WP_002953358.1 excinuclease ABC subunit UvrB -
  V6K67_RS08430 (V6K67_08430) - 1633378..1634314 (-) 937 Protein_1611 type II CAAX endopeptidase family protein -
  V6K67_RS08435 (V6K67_08435) - 1634513..1636723 (+) 2211 WP_011226350.1 ABC transporter substrate-binding protein/permease -
  V6K67_RS08440 (V6K67_08440) - 1636723..1637463 (+) 741 WP_002945131.1 amino acid ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 308 a.a.        Molecular weight: 34694.85 Da        Isoelectric Point: 9.7054

>NTDB_id=941270 V6K67_RS08195 WP_002946409.1 1583337..1584263(-) (amiD) [Streptococcus thermophilus strain TCI633]
MASIDKSKFQFVKRDDFASETIDAPSYSYWKSVMRQFFKKKSTVVMLGILITIILMSFIYPMFSKFDFNDVSKVNDFSLR
YVHPNAQYWFGTDGNGKSLFDSVWFGARNSILIAVIATFLNVIIGLLVGAVWGISKTFDMIMMEIYNIISNIPSLLVVIV
LTYSLGAGFWNMIFAMTVTGWIGIAYTIRIQIMRYRDLEYNLASRNLGTPTAKIVIKNIMPQLVSVIVTMASQLLPGFIS
YEAFLSYFGLGLPVTTPSLGRLISDYAQNVTVNAYLFWIPLTTLILVSLALFIVGQNLADASDPRTHR

Nucleotide


Download         Length: 927 bp        

>NTDB_id=941270 V6K67_RS08195 WP_002946409.1 1583337..1584263(-) (amiD) [Streptococcus thermophilus strain TCI633]
ATGGCTTCAATTGATAAAAGTAAGTTCCAATTTGTAAAGCGCGATGATTTTGCCTCTGAAACAATTGATGCACCGTCTTA
CTCATACTGGAAATCAGTGATGCGTCAATTTTTTAAAAAGAAATCAACAGTTGTAATGTTGGGAATCTTGATTACTATTA
TTTTAATGAGTTTCATCTACCCAATGTTTTCTAAATTTGACTTCAATGATGTCTCAAAAGTAAATGATTTCAGTTTGCGT
TATGTACATCCAAACGCTCAATACTGGTTCGGTACTGACGGTAATGGTAAGTCTCTATTTGACAGTGTTTGGTTTGGGGC
TCGTAATTCTATCCTTATCGCTGTTATCGCTACCTTCCTGAATGTTATAATTGGTTTGCTTGTAGGTGCTGTTTGGGGGA
TTTCTAAGACCTTCGATATGATTATGATGGAAATCTACAACATCATCTCAAATATTCCCTCTCTCCTTGTGGTTATCGTC
TTGACTTACTCATTAGGTGCTGGTTTCTGGAATATGATTTTTGCCATGACCGTAACAGGTTGGATCGGTATTGCCTATAC
AATCCGTATTCAAATCATGCGTTATCGTGATTTGGAGTATAACTTGGCTTCTCGCAATTTGGGAACACCAACGGCTAAGA
TTGTGATTAAAAATATCATGCCACAACTTGTGTCAGTTATTGTAACCATGGCTAGTCAACTTTTGCCAGGATTTATCTCT
TATGAGGCCTTCCTTTCATACTTTGGTTTGGGTCTTCCTGTTACTACGCCTAGTCTTGGTCGTTTGATTTCAGACTATGC
ACAGAACGTTACAGTCAATGCCTATCTCTTCTGGATTCCATTGACTACCTTGATTCTTGTTTCTCTTGCCCTCTTTATTG
TTGGTCAAAACTTAGCGGATGCTAGTGACCCACGTACGCATAGATAG

Domains

Predicted by InterproScan.

N-terminal TM domain of oligopeptide transport permease C (OppC_N)

(28-71)

Binding-protein-dependent transport system inner membrane component (BPD_transp_1)

(125-306)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  amiD Streptococcus thermophilus LMG 18311

100

100

1
  amiD Streptococcus thermophilus LMD-9

100

100

1
  amiD Streptococcus salivarius strain HSISS4

96.429

100

0.964