Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   V5F87_RS07800 Genome accession   NZ_CP145595
Coordinates   1610377..1611249 (-) Length   290 a.a.
NCBI ID   WP_023350397.1    Uniprot ID   -
Organism   Staphylococcus capitis strain kcgeb_sa     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1565082..1628598 1610377..1611249 within 0


Gene organization within MGE regions


Location: 1565082..1628598
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5F87_RS07620 (V5F87_07620) recA 1566643..1567695 (-) 1053 WP_098905490.1 recombinase RecA Machinery gene
  V5F87_RS07625 (V5F87_07625) - 1567864..1569012 (-) 1149 WP_023350376.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  V5F87_RS07630 (V5F87_07630) pgsA 1569155..1569736 (-) 582 WP_023350377.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  V5F87_RS07635 (V5F87_07635) - 1569764..1570156 (-) 393 WP_002436354.1 helix-turn-helix domain-containing protein -
  V5F87_RS07640 (V5F87_07640) - 1570175..1571002 (-) 828 WP_002436330.1 YmfK family protein -
  V5F87_RS07645 (V5F87_07645) - 1571161..1571868 (-) 708 WP_023350378.1 SDR family NAD(P)-dependent oxidoreductase -
  V5F87_RS07650 (V5F87_07650) - 1571868..1573154 (-) 1287 WP_023350379.1 pitrilysin family protein -
  V5F87_RS07655 (V5F87_07655) - 1573154..1574428 (-) 1275 WP_023350380.1 pitrilysin family protein -
  V5F87_RS07660 (V5F87_07660) - 1574470..1575180 (-) 711 WP_023350381.1 GntR family transcriptional regulator -
  V5F87_RS07665 (V5F87_07665) - 1575183..1577603 (-) 2421 WP_023350382.1 DNA translocase FtsK -
  V5F87_RS07670 (V5F87_07670) - 1577861..1579534 (-) 1674 WP_002469869.1 ribonuclease J -
  V5F87_RS07675 (V5F87_07675) pnp 1579768..1581867 (-) 2100 WP_023350384.1 polyribonucleotide nucleotidyltransferase -
  V5F87_RS07680 (V5F87_07680) rpsO 1582001..1582270 (-) 270 WP_002436359.1 30S ribosomal protein S15 -
  V5F87_RS07685 (V5F87_07685) ribF 1582392..1583363 (-) 972 WP_338499758.1 riboflavin biosynthesis protein RibF -
  V5F87_RS07690 (V5F87_07690) truB 1583379..1584296 (-) 918 WP_023350385.1 tRNA pseudouridine(55) synthase TruB -
  V5F87_RS07695 (V5F87_07695) rbfA 1584445..1584795 (-) 351 WP_002436301.1 30S ribosome-binding factor RbfA -
  V5F87_RS07700 (V5F87_07700) infB 1584952..1587126 (-) 2175 WP_023350386.1 translation initiation factor IF-2 -
  V5F87_RS07705 (V5F87_07705) - 1587131..1587448 (-) 318 WP_002436350.1 ribosomal L7Ae/L30e/S12e/Gadd45 family protein -
  V5F87_RS07710 (V5F87_07710) - 1587445..1587729 (-) 285 WP_002436310.1 YlxR family protein -
  V5F87_RS07715 (V5F87_07715) nusA 1587746..1588969 (-) 1224 WP_002436342.1 transcription termination factor NusA -
  V5F87_RS07720 (V5F87_07720) rimP 1588990..1589457 (-) 468 WP_002436317.1 ribosome maturation factor RimP -
  V5F87_RS07725 (V5F87_07725) - 1589682..1593992 (-) 4311 WP_087671603.1 PolC-type DNA polymerase III -
  V5F87_RS07730 (V5F87_07730) - 1594248..1595951 (-) 1704 WP_049326556.1 proline--tRNA ligase -
  V5F87_RS07735 (V5F87_07735) rseP 1595971..1597257 (-) 1287 WP_023350389.1 RIP metalloprotease RseP -
  V5F87_RS07740 (V5F87_07740) - 1597497..1598279 (-) 783 WP_002436308.1 phosphatidate cytidylyltransferase -
  V5F87_RS07745 (V5F87_07745) - 1598283..1599053 (-) 771 WP_023350390.1 isoprenyl transferase -
  V5F87_RS07750 (V5F87_07750) frr 1599334..1599888 (-) 555 WP_002436295.1 ribosome recycling factor -
  V5F87_RS07755 (V5F87_07755) pyrH 1599905..1600627 (-) 723 WP_002436299.1 UMP kinase -
  V5F87_RS07760 (V5F87_07760) tsf 1600764..1601642 (-) 879 WP_030064793.1 translation elongation factor Ts -
  V5F87_RS07765 (V5F87_07765) rpsB 1601793..1602581 (-) 789 WP_002436327.1 30S ribosomal protein S2 -
  V5F87_RS07770 (V5F87_07770) codY 1602835..1603608 (-) 774 WP_338499765.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  V5F87_RS07775 (V5F87_07775) hslU 1603631..1605034 (-) 1404 WP_023350392.1 ATP-dependent protease ATPase subunit HslU -
  V5F87_RS07780 (V5F87_07780) hslV 1605118..1605660 (-) 543 WP_023350393.1 ATP-dependent protease subunit HslV -
  V5F87_RS07785 (V5F87_07785) xerC 1605664..1606554 (-) 891 WP_023350394.1 tyrosine recombinase XerC -
  V5F87_RS07790 (V5F87_07790) trmFO 1606791..1608098 (-) 1308 WP_023350395.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  V5F87_RS07795 (V5F87_07795) topA 1608124..1610199 (-) 2076 WP_030064789.1 type I DNA topoisomerase -
  V5F87_RS07800 (V5F87_07800) dprA 1610377..1611249 (-) 873 WP_023350397.1 DNA-processing protein DprA Machinery gene
  V5F87_RS07805 (V5F87_07805) sucD 1611475..1612383 (-) 909 WP_002436344.1 succinate--CoA ligase subunit alpha -
  V5F87_RS07810 (V5F87_07810) sucC 1612405..1613571 (-) 1167 WP_002436291.1 ADP-forming succinate--CoA ligase subunit beta -
  V5F87_RS07815 (V5F87_07815) - 1613679..1614449 (-) 771 WP_023350398.1 ribonuclease HII -
  V5F87_RS07820 (V5F87_07820) ylqF 1614433..1615316 (-) 884 Protein_1502 ribosome biogenesis GTPase YlqF -
  V5F87_RS07825 (V5F87_07825) - 1615596..1618196 (+) 2601 WP_023350400.1 YfhO family protein -
  V5F87_RS07830 (V5F87_07830) - 1618189..1620795 (+) 2607 WP_023350401.1 YfhO family protein -
  V5F87_RS07835 (V5F87_07835) - 1621275..1621481 (+) 207 WP_226859621.1 hypothetical protein -
  V5F87_RS07840 (V5F87_07840) - 1621521..1621859 (+) 339 WP_023350404.1 hypothetical protein -
  V5F87_RS07845 (V5F87_07845) rplS 1622436..1622786 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  V5F87_RS07850 (V5F87_07850) trmD 1622892..1623629 (-) 738 WP_023350405.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  V5F87_RS07855 (V5F87_07855) rimM 1623629..1624132 (-) 504 WP_023350406.1 ribosome maturation factor RimM -
  V5F87_RS07860 (V5F87_07860) rpsP 1624395..1624670 (-) 276 WP_002453071.1 30S ribosomal protein S16 -
  V5F87_RS07865 (V5F87_07865) ffh 1625098..1626465 (-) 1368 WP_002435148.1 signal recognition particle protein -
  V5F87_RS07870 (V5F87_07870) - 1626495..1626827 (-) 333 WP_002435170.1 putative DNA-binding protein -
  V5F87_RS07875 (V5F87_07875) ftsY 1626814..1628073 (-) 1260 WP_023350407.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33411.79 Da        Isoelectric Point: 9.7513

>NTDB_id=938941 V5F87_RS07800 WP_023350397.1 1610377..1611249(-) (dprA) [Staphylococcus capitis strain kcgeb_sa]
MIQHTLLKLYWANFATTQVHQFIKEYPEVISENALIQNKMIEDWAKRQTSSTVRRKLSLFKSLNTEVIFQEMTKMNLKYL
TYFDKHYPQLLKEIYDFPYVIFYKGNKQLFNCPHTLAVIGSRKSTLYTTQALEYLFPSFKSLKMTIISGLAYGADSIAHQ
VALKNKLPTIGVLGFGHSYHYPKSSLKTRENIERKGLVISEYPPHSPITRYKFPERNRLISGLARGLLITEAEKISGSQI
TVDCALEQNRNVYVLPGSMFNPMTKSNLLRLQEGAQVVLDECSILSDYIF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=938941 V5F87_RS07800 WP_023350397.1 1610377..1611249(-) (dprA) [Staphylococcus capitis strain kcgeb_sa]
GTGATTCAACACACTTTATTGAAGCTCTATTGGGCTAATTTCGCCACAACGCAAGTTCATCAATTTATTAAAGAATATCC
AGAAGTTATTTCAGAAAACGCACTAATTCAAAATAAGATGATTGAGGATTGGGCTAAAAGACAAACCTCATCCACAGTCA
GGAGAAAATTGAGCTTATTTAAATCACTTAATACAGAAGTTATATTTCAAGAAATGACTAAAATGAACCTCAAATATTTA
ACTTACTTTGATAAACATTATCCTCAATTACTTAAAGAAATTTATGATTTCCCATATGTAATTTTTTATAAAGGAAATAA
ACAACTATTTAATTGTCCTCATACTTTAGCTGTTATAGGCTCAAGAAAGTCAACCTTATATACAACTCAAGCTTTGGAAT
ATCTTTTCCCATCATTTAAATCACTAAAAATGACGATTATTTCAGGATTAGCATATGGTGCAGATAGTATAGCTCACCAA
GTCGCACTAAAAAATAAACTTCCAACAATAGGCGTTCTTGGCTTCGGCCATTCATATCATTATCCTAAATCATCTTTAAA
GACAAGAGAGAATATCGAACGAAAAGGACTAGTTATAAGTGAGTATCCACCTCATTCTCCCATAACCAGATATAAATTTC
CTGAAAGAAATAGATTGATTAGTGGACTCGCTCGGGGTCTATTAATTACAGAAGCAGAGAAAATAAGCGGTAGTCAAATA
ACAGTAGACTGCGCTTTAGAACAAAACCGGAATGTATATGTTTTACCAGGATCAATGTTTAATCCTATGACCAAAAGTAA
TTTACTTAGACTTCAAGAGGGGGCACAAGTCGTTTTAGATGAATGTAGTATTCTTTCAGACTACATTTTCTAA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

59.028

99.31

0.586
  dprA Staphylococcus aureus MW2

59.028

99.31

0.586