Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   V6C94_RS09770 Genome accession   NZ_CP145253
Coordinates   1998897..1999472 (-) Length   191 a.a.
NCBI ID   WP_023350568.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1191106     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1953655..1998493 1998897..1999472 flank 404


Gene organization within MGE regions


Location: 1953655..1999472
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6C94_RS09440 (V6C94_09455) - 1953655..1953840 (-) 186 WP_072098668.1 hypothetical protein -
  V6C94_RS09445 (V6C94_09460) - 1953842..1953952 (-) 111 WP_087671645.1 hypothetical protein -
  V6C94_RS09450 (V6C94_09465) - 1954023..1954151 (-) 129 WP_016898262.1 hypothetical protein -
  V6C94_RS09455 (V6C94_09470) - 1954324..1955787 (-) 1464 WP_072098669.1 SH3 domain-containing protein -
  V6C94_RS09460 (V6C94_09475) - 1955762..1956172 (-) 411 WP_072098670.1 phage holin -
  V6C94_RS09465 (V6C94_09480) - 1956231..1957706 (-) 1476 WP_072098671.1 SGNH/GDSL hydrolase family protein -
  V6C94_RS09470 (V6C94_09485) - 1957748..1957894 (-) 147 WP_072098672.1 XkdX family protein -
  V6C94_RS09475 (V6C94_09490) - 1957887..1958225 (-) 339 WP_072098673.1 hypothetical protein -
  V6C94_RS09480 (V6C94_09495) - 1958237..1959898 (-) 1662 WP_072098674.1 BppU family phage baseplate upper protein -
  V6C94_RS09485 (V6C94_09500) - 1959953..1961761 (-) 1809 WP_080986623.1 glucosaminidase domain-containing protein -
  V6C94_RS09490 (V6C94_09505) - 1961838..1962455 (-) 618 WP_072098675.1 AP2 domain-containing protein -
  V6C94_RS09495 (V6C94_09510) - 1962676..1962807 (-) 132 WP_290367077.1 hypothetical protein -
  V6C94_RS09500 (V6C94_09515) - 1962861..1963259 (-) 399 WP_002436470.1 hypothetical protein -
  V6C94_RS09505 (V6C94_09520) - 1963240..1963662 (-) 423 WP_072098676.1 hypothetical protein -
  V6C94_RS09510 (V6C94_09525) - 1963676..1964863 (-) 1188 WP_367010064.1 BppU family phage baseplate upper protein -
  V6C94_RS09515 (V6C94_09530) - 1964876..1966762 (-) 1887 WP_072098678.1 M14 family metallopeptidase -
  V6C94_RS09520 (V6C94_09535) - 1966765..1968225 (-) 1461 WP_072098679.1 phage tail protein -
  V6C94_RS09525 (V6C94_09540) - 1968237..1969193 (-) 957 WP_049399458.1 phage tail domain-containing protein -
  V6C94_RS09530 (V6C94_09545) - 1969205..1973113 (-) 3909 WP_072098680.1 phage tail protein -
  V6C94_RS09535 (V6C94_09550) - 1973128..1973472 (-) 345 WP_037549628.1 hypothetical protein -
  V6C94_RS09540 (V6C94_09555) - 1973514..1973873 (-) 360 WP_037549630.1 tail assembly chaperone -
  V6C94_RS09545 (V6C94_09560) - 1973938..1974495 (-) 558 WP_037549633.1 phage major tail protein, TP901-1 family -
  V6C94_RS09550 (V6C94_09565) - 1974537..1974926 (-) 390 WP_072098681.1 hypothetical protein -
  V6C94_RS09555 (V6C94_09570) - 1974926..1975288 (-) 363 WP_037549639.1 HK97-gp10 family putative phage morphogenesis protein -
  V6C94_RS09560 (V6C94_09575) - 1975288..1975590 (-) 303 WP_072098682.1 hypothetical protein -
  V6C94_RS09565 (V6C94_09580) - 1975587..1975916 (-) 330 WP_049399465.1 phage head-tail connector protein -
  V6C94_RS09570 (V6C94_09585) - 1975918..1976187 (-) 270 WP_072098683.1 hypothetical protein -
  V6C94_RS09575 (V6C94_09590) - 1976208..1977137 (-) 930 WP_072098684.1 phage major capsid protein -
  V6C94_RS09580 (V6C94_09595) - 1977154..1977765 (-) 612 WP_072098685.1 DUF4355 domain-containing protein -
  V6C94_RS09585 (V6C94_09600) - 1977935..1978078 (-) 144 WP_165764330.1 hypothetical protein -
  V6C94_RS09590 (V6C94_09605) - 1978071..1978616 (-) 546 WP_072098686.1 hypothetical protein -
  V6C94_RS09595 (V6C94_09610) - 1978630..1979568 (-) 939 WP_002493382.1 minor capsid protein -
  V6C94_RS09600 (V6C94_09615) - 1979575..1981101 (-) 1527 WP_072098687.1 phage portal protein -
  V6C94_RS09605 (V6C94_09620) - 1981113..1982393 (-) 1281 WP_072098688.1 PBSX family phage terminase large subunit -
  V6C94_RS09610 (V6C94_09625) - 1982380..1982817 (-) 438 WP_029625721.1 terminase small subunit -
  V6C94_RS09615 (V6C94_09630) - 1983073..1983474 (-) 402 WP_072098689.1 hypothetical protein -
  V6C94_RS09620 (V6C94_09635) - 1983599..1983775 (-) 177 WP_072098690.1 transcriptional regulator -
  V6C94_RS09625 (V6C94_09640) - 1983827..1984348 (-) 522 WP_072098691.1 dUTP diphosphatase -
  V6C94_RS09630 (V6C94_09645) - 1984349..1984507 (-) 159 WP_171817096.1 hypothetical protein -
  V6C94_RS09635 (V6C94_09650) - 1984504..1984818 (-) 315 WP_072098692.1 hypothetical protein -
  V6C94_RS09640 (V6C94_09655) - 1984815..1985294 (-) 480 WP_072098693.1 nucleoside 2-deoxyribosyltransferase -
  V6C94_RS09645 (V6C94_09660) - 1985297..1985494 (-) 198 WP_002469782.1 hypothetical protein -
  V6C94_RS09650 (V6C94_09665) - 1985495..1985860 (-) 366 WP_072098694.1 SA1788 family PVL leukocidin-associated protein -
  V6C94_RS09655 (V6C94_09670) - 1985861..1986052 (-) 192 WP_072098697.1 hypothetical protein -
  V6C94_RS09660 (V6C94_09675) - 1986250..1986405 (-) 156 WP_168995397.1 hypothetical protein -
  V6C94_RS09665 (V6C94_09680) - 1986399..1987169 (-) 771 WP_367121996.1 ATP-binding protein -
  V6C94_RS09670 (V6C94_09685) - 1987180..1987971 (-) 792 WP_002442302.1 conserved phage C-terminal domain-containing protein -
  V6C94_RS09675 (V6C94_09690) - 1987958..1988719 (-) 762 WP_367121990.1 HNH endonuclease -
  V6C94_RS09680 (V6C94_09695) - 1988716..1989387 (-) 672 WP_037549713.1 putative HNHc nuclease -
  V6C94_RS09685 (V6C94_09700) - 1989399..1989944 (-) 546 WP_011276639.1 hypothetical protein -
  V6C94_RS09690 (V6C94_09705) - 1989976..1990761 (-) 786 WP_367121991.1 AAA family ATPase -
  V6C94_RS09695 (V6C94_09710) - 1990762..1991247 (-) 486 WP_072098732.1 siphovirus Gp157 family protein -
  V6C94_RS09700 (V6C94_09715) - 1991240..1991494 (-) 255 WP_072098733.1 hypothetical protein -
  V6C94_RS09705 (V6C94_09720) - 1991559..1991732 (-) 174 WP_171817102.1 hypothetical protein -
  V6C94_RS09710 (V6C94_09725) - 1991888..1992121 (+) 234 WP_037549720.1 hypothetical protein -
  V6C94_RS09715 (V6C94_09730) - 1992105..1992269 (-) 165 WP_168997567.1 hypothetical protein -
  V6C94_RS09720 (V6C94_09735) - 1992283..1992492 (-) 210 WP_037549723.1 hypothetical protein -
  V6C94_RS09725 (V6C94_09740) - 1992578..1992811 (-) 234 WP_072098734.1 MW1434 family type I TA system toxin -
  V6C94_RS09730 (V6C94_09745) - 1992878..1993645 (-) 768 WP_072098735.1 ParB/Srx family N-terminal domain-containing protein -
  V6C94_RS09735 (V6C94_09750) - 1993642..1994595 (-) 954 WP_002478856.1 ParB N-terminal domain-containing protein -
  V6C94_RS09740 (V6C94_09755) - 1994623..1994850 (-) 228 WP_002474229.1 hypothetical protein -
  V6C94_RS09745 (V6C94_09760) - 1995022..1995633 (+) 612 WP_072098736.1 S24 family peptidase -
  V6C94_RS09750 (V6C94_09765) - 1995726..1997384 (+) 1659 WP_072098737.1 DpnII family type II restriction endonuclease -
  V6C94_RS09755 (V6C94_09770) - 1997444..1998493 (+) 1050 WP_072098738.1 site-specific integrase -
  V6C94_RS09770 (V6C94_09785) comK/comK1 1998897..1999472 (-) 576 WP_023350568.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22722.82 Da        Isoelectric Point: 9.5768

>NTDB_id=938285 V6C94_RS09770 WP_023350568.1 1998897..1999472(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1191106]
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDNIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK

Nucleotide


Download         Length: 576 bp        

>NTDB_id=938285 V6C94_RS09770 WP_023350568.1 1998897..1999472(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1191106]
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAAAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGCAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAACATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(8-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.064

98.429

0.749
  comK/comK1 Staphylococcus aureus N315

76.064

98.429

0.749