Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   V6C62_RS09310 Genome accession   NZ_CP145249
Coordinates   1899545..1900120 (-) Length   191 a.a.
NCBI ID   WP_023350568.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1365666     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1855953..1899033 1899545..1900120 flank 512


Gene organization within MGE regions


Location: 1855953..1900120
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6C62_RS08975 (V6C62_08970) - 1855953..1856150 (-) 198 WP_023350503.1 hypothetical protein -
  V6C62_RS08980 (V6C62_08975) - 1857086..1857283 (-) 198 WP_081253920.1 hypothetical protein -
  V6C62_RS08985 (V6C62_08980) - 1857473..1857604 (-) 132 WP_259978902.1 hypothetical protein -
  V6C62_RS08990 (V6C62_08985) - 1857775..1859238 (-) 1464 WP_337225390.1 SH3 domain-containing protein -
  V6C62_RS08995 (V6C62_08990) - 1859213..1859623 (-) 411 WP_016064965.1 phage holin -
  V6C62_RS09000 (V6C62_08995) - 1859687..1859833 (-) 147 WP_002502836.1 XkdX family protein -
  V6C62_RS09005 (V6C62_09000) - 1859826..1860185 (-) 360 WP_337225391.1 hypothetical protein -
  V6C62_RS09010 (V6C62_09005) - 1860196..1861545 (-) 1350 WP_337225392.1 BppU family phage baseplate upper protein -
  V6C62_RS09015 (V6C62_09010) - 1861665..1862072 (-) 408 WP_337225393.1 hypothetical protein -
  V6C62_RS09020 (V6C62_09015) - 1862062..1862484 (-) 423 WP_337225394.1 hypothetical protein -
  V6C62_RS09025 (V6C62_09020) - 1862481..1863104 (-) 624 WP_337225395.1 poly-gamma-glutamate hydrolase family protein -
  V6C62_RS09030 (V6C62_09025) - 1863109..1864323 (-) 1215 WP_337225396.1 BppU family phage baseplate upper protein -
  V6C62_RS09035 (V6C62_09030) - 1864323..1866185 (-) 1863 WP_337225397.1 M14 family metallopeptidase -
  V6C62_RS09040 (V6C62_09035) - 1866201..1866374 (-) 174 WP_168992842.1 hypothetical protein -
  V6C62_RS09045 (V6C62_09040) - 1866367..1867926 (-) 1560 WP_337225398.1 prophage endopeptidase tail family protein -
  V6C62_RS09050 (V6C62_09045) - 1867936..1868769 (-) 834 WP_367140207.1 phage tail domain-containing protein -
  V6C62_RS09055 (V6C62_09050) - 1868771..1873672 (-) 4902 Protein_1749 phage tail tape measure protein -
  V6C62_RS09060 (V6C62_09055) - 1873701..1873853 (-) 153 WP_002503474.1 hypothetical protein -
  V6C62_RS09065 (V6C62_09060) - 1873886..1874248 (-) 363 WP_367140209.1 hypothetical protein -
  V6C62_RS09070 (V6C62_09065) - 1874319..1874504 (-) 186 WP_070840827.1 hypothetical protein -
  V6C62_RS09075 (V6C62_09070) - 1874523..1875149 (-) 627 WP_367140211.1 major tail protein -
  V6C62_RS09080 (V6C62_09075) - 1875162..1875566 (-) 405 WP_367140213.1 hypothetical protein -
  V6C62_RS09085 (V6C62_09080) - 1875571..1875837 (-) 267 WP_002453526.1 hypothetical protein -
  V6C62_RS09090 (V6C62_09085) - 1875972..1876301 (-) 330 WP_002453527.1 head-tail adaptor protein -
  V6C62_RS09095 (V6C62_09090) - 1876291..1876632 (-) 342 WP_016064949.1 head-tail connector protein -
  V6C62_RS09100 (V6C62_09095) - 1876651..1878009 (-) 1359 WP_367140215.1 phage major capsid protein -
  V6C62_RS09105 (V6C62_09100) - 1878050..1878607 (-) 558 WP_367140216.1 HK97 family phage prohead protease -
  V6C62_RS09110 (V6C62_09105) - 1878597..1879829 (-) 1233 WP_016064946.1 phage portal protein -
  V6C62_RS09115 (V6C62_09110) - 1879832..1880026 (-) 195 WP_070840821.1 hypothetical protein -
  V6C62_RS09120 (V6C62_09115) - 1880040..1881791 (-) 1752 WP_070840820.1 terminase TerL endonuclease subunit -
  V6C62_RS09125 (V6C62_09120) - 1881784..1882254 (-) 471 WP_337225407.1 phage terminase small subunit P27 family -
  V6C62_RS09130 (V6C62_09125) - 1882399..1882758 (-) 360 WP_337225429.1 HNH endonuclease signature motif containing protein -
  V6C62_RS09135 (V6C62_09130) - 1883373..1883819 (-) 447 WP_002453536.1 transcriptional regulator -
  V6C62_RS09140 (V6C62_09135) - 1883836..1883985 (-) 150 WP_002456391.1 DUF1514 domain-containing protein -
  V6C62_RS09145 (V6C62_09140) - 1883986..1884165 (-) 180 WP_337225408.1 regulator -
  V6C62_RS09150 (V6C62_09145) dut 1884214..1884639 (-) 426 WP_367140476.1 dUTP diphosphatase -
  V6C62_RS09155 (V6C62_09150) - 1884966..1885415 (-) 450 WP_230455161.1 DUF3310 domain-containing protein -
  V6C62_RS09160 (V6C62_09155) - 1885420..1885782 (-) 363 WP_367140219.1 SA1788 family PVL leukocidin-associated protein -
  V6C62_RS09165 (V6C62_09160) - 1885783..1885977 (-) 195 WP_367008543.1 hypothetical protein -
  V6C62_RS09170 (V6C62_09165) - 1885970..1886377 (-) 408 WP_367140221.1 DUF1064 domain-containing protein -
  V6C62_RS09175 (V6C62_09170) - 1886386..1886631 (-) 246 WP_016064930.1 DUF3269 family protein -
  V6C62_RS09180 (V6C62_09175) - 1886609..1886830 (-) 222 WP_016064929.1 hypothetical protein -
  V6C62_RS09185 (V6C62_09180) - 1886827..1888062 (-) 1236 WP_367140223.1 DnaB helicase C-terminal domain-containing protein -
  V6C62_RS09190 (V6C62_09185) - 1888055..1888414 (-) 360 WP_002468960.1 hypothetical protein -
  V6C62_RS09195 (V6C62_09190) - 1888414..1889214 (-) 801 WP_367140225.1 phage replisome organizer N-terminal domain-containing protein -
  V6C62_RS09200 (V6C62_09195) - 1889192..1889308 (-) 117 Protein_1778 putative HNHc nuclease -
  V6C62_RS09205 (V6C62_09200) - 1889289..1889879 (-) 591 WP_367140227.1 NUMOD4 motif-containing HNH endonuclease -
  V6C62_RS09210 (V6C62_09205) - 1889880..1890545 (-) 666 WP_367140229.1 putative HNHc nuclease -
  V6C62_RS09215 (V6C62_09210) - 1890546..1891100 (-) 555 WP_367140231.1 NUMOD4 domain-containing protein -
  V6C62_RS09220 (V6C62_09215) - 1891112..1891522 (-) 411 WP_367140233.1 single-stranded DNA-binding protein -
  V6C62_RS09225 (V6C62_09220) - 1891515..1892156 (-) 642 WP_367140235.1 DUF1071 domain-containing protein -
  V6C62_RS09230 (V6C62_09225) - 1892149..1892400 (-) 252 WP_002485808.1 hypothetical protein -
  V6C62_RS09235 (V6C62_09230) - 1892378..1892647 (-) 270 WP_367140237.1 chordopoxvirus fusion protein -
  V6C62_RS09240 (V6C62_09235) - 1892708..1892881 (-) 174 WP_367140239.1 hypothetical protein -
  V6C62_RS09245 (V6C62_09240) - 1892894..1893106 (-) 213 WP_070840807.1 DUF771 domain-containing protein -
  V6C62_RS09250 (V6C62_09245) - 1893108..1893272 (-) 165 WP_176746971.1 hypothetical protein -
  V6C62_RS09255 (V6C62_09250) - 1893286..1894059 (-) 774 WP_367140241.1 phage antirepressor -
  V6C62_RS09260 (V6C62_09255) - 1894108..1894314 (+) 207 WP_162194976.1 hypothetical protein -
  V6C62_RS09265 (V6C62_09260) - 1894303..1894467 (-) 165 WP_196308546.1 hypothetical protein -
  V6C62_RS09270 (V6C62_09265) - 1894480..1894719 (-) 240 WP_367140243.1 helix-turn-helix domain-containing protein -
  V6C62_RS09275 (V6C62_09270) - 1894913..1895242 (+) 330 WP_002493408.1 helix-turn-helix transcriptional regulator -
  V6C62_RS09280 (V6C62_09275) - 1895254..1895718 (+) 465 WP_367140245.1 ImmA/IrrE family metallo-endopeptidase -
  V6C62_RS09285 (V6C62_09280) - 1895737..1896762 (+) 1026 WP_195850043.1 adenine-specific methyltransferase EcoRI family protein -
  V6C62_RS09290 (V6C62_09285) - 1896752..1897840 (+) 1089 WP_242244114.1 DUF262 domain-containing protein -
  V6C62_RS09295 (V6C62_09290) - 1897972..1899033 (+) 1062 WP_337225422.1 tyrosine-type recombinase/integrase -
  V6C62_RS09310 (V6C62_09305) comK/comK1 1899545..1900120 (-) 576 WP_023350568.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22722.82 Da        Isoelectric Point: 9.5768

>NTDB_id=938215 V6C62_RS09310 WP_023350568.1 1899545..1900120(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365666]
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDNIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK

Nucleotide


Download         Length: 576 bp        

>NTDB_id=938215 V6C62_RS09310 WP_023350568.1 1899545..1900120(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365666]
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAAAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGCAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAACATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(8-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.064

98.429

0.749
  comK/comK1 Staphylococcus aureus N315

76.064

98.429

0.749