Detailed information
Bioinformatically predicted
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | V6D01_RS09095 | Genome accession | NZ_CP145244 |
| Coordinates | 1858870..1859445 (-) | Length | 191 a.a. |
| NCBI ID | WP_023350568.1 | Uniprot ID | - |
| Organism | Staphylococcus capitis subsp. urealyticus strain Sc1365670 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1813647..1858358 | 1858870..1859445 | flank | 512 |
Gene organization within MGE regions
Location: 1813647..1859445
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V6D01_RS08725 (V6D01_08705) | - | 1813647..1813844 (-) | 198 | WP_023350503.1 | hypothetical protein | - |
| V6D01_RS08730 (V6D01_08710) | - | 1814824..1816287 (-) | 1464 | WP_367122772.1 | SH3 domain-containing protein | - |
| V6D01_RS08735 (V6D01_08715) | - | 1816262..1816672 (-) | 411 | WP_023350506.1 | phage holin | - |
| V6D01_RS08740 (V6D01_08720) | - | 1816717..1817250 (-) | 534 | WP_367122774.1 | hypothetical protein | - |
| V6D01_RS08745 (V6D01_08725) | - | 1817250..1817765 (-) | 516 | WP_206414095.1 | hypothetical protein | - |
| V6D01_RS08750 (V6D01_08730) | - | 1817806..1817952 (-) | 147 | WP_102695953.1 | XkdX family protein | - |
| V6D01_RS08755 (V6D01_08735) | - | 1817945..1818274 (-) | 330 | WP_367122775.1 | hypothetical protein | - |
| V6D01_RS08760 (V6D01_08740) | - | 1818286..1819281 (-) | 996 | WP_367122776.1 | BppU family phage baseplate upper protein | - |
| V6D01_RS08765 (V6D01_08745) | - | 1819334..1820536 (-) | 1203 | WP_367122777.1 | N-acetylglucosaminidase | - |
| V6D01_RS08770 (V6D01_08750) | - | 1821185..1821421 (-) | 237 | Protein_1670 | CHAP domain-containing protein | - |
| V6D01_RS08775 (V6D01_08755) | - | 1821736..1821867 (-) | 132 | WP_255263171.1 | hypothetical protein | - |
| V6D01_RS08780 (V6D01_08760) | - | 1821921..1822319 (-) | 399 | WP_367122779.1 | hypothetical protein | - |
| V6D01_RS08785 (V6D01_08765) | - | 1822300..1822722 (-) | 423 | WP_002470002.1 | hypothetical protein | - |
| V6D01_RS08790 (V6D01_08770) | - | 1822736..1823923 (-) | 1188 | WP_367122780.1 | BppU family phage baseplate upper protein | - |
| V6D01_RS08795 (V6D01_08775) | - | 1823936..1825822 (-) | 1887 | WP_367122781.1 | M14 family metallopeptidase | - |
| V6D01_RS08800 (V6D01_08780) | - | 1825825..1827285 (-) | 1461 | WP_367122782.1 | phage tail protein | - |
| V6D01_RS08805 (V6D01_08785) | - | 1827297..1828253 (-) | 957 | WP_367122783.1 | phage tail domain-containing protein | - |
| V6D01_RS08810 (V6D01_08790) | - | 1828265..1832173 (-) | 3909 | WP_367122784.1 | phage tail protein | - |
| V6D01_RS08815 (V6D01_08795) | - | 1832188..1832532 (-) | 345 | WP_367122785.1 | hypothetical protein | - |
| V6D01_RS08820 (V6D01_08800) | - | 1832574..1832933 (-) | 360 | WP_367122786.1 | tail assembly chaperone | - |
| V6D01_RS08825 (V6D01_08805) | - | 1832994..1833548 (-) | 555 | WP_002436441.1 | phage major tail protein, TP901-1 family | - |
| V6D01_RS08830 (V6D01_08810) | - | 1833595..1833984 (-) | 390 | WP_367122787.1 | hypothetical protein | - |
| V6D01_RS08835 (V6D01_08815) | - | 1833995..1834354 (-) | 360 | WP_367122788.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| V6D01_RS08840 (V6D01_08820) | - | 1834354..1834656 (-) | 303 | WP_367122789.1 | hypothetical protein | - |
| V6D01_RS08845 (V6D01_08825) | - | 1834653..1834982 (-) | 330 | WP_002436519.1 | phage head-tail connector protein | - |
| V6D01_RS08850 (V6D01_08830) | - | 1834984..1835253 (-) | 270 | WP_367122790.1 | hypothetical protein | - |
| V6D01_RS08855 (V6D01_08835) | - | 1835276..1836190 (-) | 915 | WP_367122791.1 | phage major capsid protein | - |
| V6D01_RS08860 (V6D01_08840) | - | 1836208..1836813 (-) | 606 | WP_367122792.1 | DUF4355 domain-containing protein | - |
| V6D01_RS08865 (V6D01_08845) | - | 1837067..1837210 (-) | 144 | WP_169922991.1 | hypothetical protein | - |
| V6D01_RS08870 (V6D01_08850) | - | 1837203..1837748 (-) | 546 | WP_367122793.1 | hypothetical protein | - |
| V6D01_RS08875 (V6D01_08855) | - | 1837768..1838718 (-) | 951 | Protein_1691 | minor capsid protein | - |
| V6D01_RS08880 (V6D01_08860) | - | 1838725..1840221 (-) | 1497 | WP_367122794.1 | phage portal protein | - |
| V6D01_RS08885 (V6D01_08865) | - | 1840235..1841527 (-) | 1293 | WP_367122795.1 | PBSX family phage terminase large subunit | - |
| V6D01_RS08890 (V6D01_08870) | - | 1841520..1841864 (-) | 345 | WP_268218651.1 | phBC6A51 family helix-turn-helix protein | - |
| V6D01_RS08895 (V6D01_08875) | - | 1842140..1842556 (-) | 417 | WP_367122796.1 | transcriptional regulator | - |
| V6D01_RS08900 (V6D01_08880) | - | 1842627..1842794 (-) | 168 | WP_367122797.1 | regulator | - |
| V6D01_RS08905 (V6D01_08885) | dut | 1842843..1843265 (-) | 423 | WP_367122798.1 | dUTP diphosphatase | - |
| V6D01_RS08910 (V6D01_08890) | - | 1843266..1843457 (-) | 192 | WP_367122799.1 | hypothetical protein | - |
| V6D01_RS08915 (V6D01_08895) | - | 1843444..1843593 (-) | 150 | WP_367122800.1 | hypothetical protein | - |
| V6D01_RS08920 (V6D01_08900) | - | 1843642..1843845 (-) | 204 | WP_367122801.1 | hypothetical protein | - |
| V6D01_RS08925 (V6D01_08905) | - | 1843829..1844260 (-) | 432 | WP_367122802.1 | hypothetical protein | - |
| V6D01_RS08930 (V6D01_08910) | - | 1844247..1844432 (-) | 186 | WP_367123000.1 | hypothetical protein | - |
| V6D01_RS08935 (V6D01_08915) | - | 1844583..1844897 (-) | 315 | Protein_1703 | nucleoside 2-deoxyribosyltransferase | - |
| V6D01_RS08940 (V6D01_08920) | - | 1844894..1845097 (-) | 204 | WP_367122803.1 | hypothetical protein | - |
| V6D01_RS08945 (V6D01_08925) | - | 1845098..1845463 (-) | 366 | WP_367122804.1 | SA1788 family PVL leukocidin-associated protein | - |
| V6D01_RS08950 (V6D01_08930) | - | 1845464..1845658 (-) | 195 | WP_367122805.1 | hypothetical protein | - |
| V6D01_RS08955 (V6D01_08935) | - | 1845651..1846058 (-) | 408 | WP_367122806.1 | DUF1064 domain-containing protein | - |
| V6D01_RS08960 (V6D01_08940) | - | 1846067..1846312 (-) | 246 | WP_367122807.1 | hypothetical protein | - |
| V6D01_RS08965 (V6D01_08945) | - | 1846315..1846470 (-) | 156 | WP_049399495.1 | hypothetical protein | - |
| V6D01_RS08970 (V6D01_08950) | - | 1846464..1847234 (-) | 771 | WP_367122808.1 | ATP-binding protein | - |
| V6D01_RS08975 (V6D01_08955) | - | 1847245..1848015 (-) | 771 | WP_367123001.1 | conserved phage C-terminal domain-containing protein | - |
| V6D01_RS08980 (V6D01_08960) | - | 1848002..1848682 (-) | 681 | WP_367122809.1 | putative HNHc nuclease | - |
| V6D01_RS08985 (V6D01_08965) | ssbA | 1848698..1849126 (-) | 429 | WP_367122810.1 | single-stranded DNA-binding protein | Machinery gene |
| V6D01_RS08990 (V6D01_08970) | - | 1849119..1849772 (-) | 654 | WP_367122811.1 | ERF family protein | - |
| V6D01_RS08995 (V6D01_08975) | - | 1849765..1849986 (-) | 222 | WP_002469938.1 | DUF2483 family protein | - |
| V6D01_RS09000 (V6D01_08980) | - | 1849952..1850234 (-) | 283 | Protein_1716 | chordopoxvirus fusion protein | - |
| V6D01_RS09005 (V6D01_08985) | - | 1850256..1850474 (-) | 219 | WP_023350553.1 | hypothetical protein | - |
| V6D01_RS09010 (V6D01_08990) | - | 1850486..1850698 (-) | 213 | WP_367122812.1 | DUF771 domain-containing protein | - |
| V6D01_RS09015 (V6D01_08995) | - | 1850702..1850869 (-) | 168 | WP_023350555.1 | hypothetical protein | - |
| V6D01_RS09020 (V6D01_09000) | - | 1850971..1851165 (-) | 195 | WP_023350556.1 | hypothetical protein | - |
| V6D01_RS09025 (V6D01_09005) | - | 1851248..1851424 (+) | 177 | WP_023350557.1 | hypothetical protein | - |
| V6D01_RS09030 (V6D01_09010) | - | 1851450..1851548 (-) | 99 | Protein_1722 | hypothetical protein | - |
| V6D01_RS09035 (V6D01_09015) | - | 1851638..1851814 (-) | 177 | WP_023350559.1 | hypothetical protein | - |
| V6D01_RS09040 (V6D01_09020) | - | 1851897..1852667 (-) | 771 | WP_023350560.1 | DUF6551 family protein | - |
| V6D01_RS09045 (V6D01_09025) | - | 1852664..1853620 (-) | 957 | WP_049307539.1 | ParB N-terminal domain-containing protein | - |
| V6D01_RS09050 (V6D01_09030) | - | 1853636..1853875 (-) | 240 | WP_367122814.1 | helix-turn-helix domain-containing protein | - |
| V6D01_RS09055 (V6D01_09035) | - | 1854069..1854398 (+) | 330 | WP_002469947.1 | helix-turn-helix transcriptional regulator | - |
| V6D01_RS09060 (V6D01_09040) | - | 1854410..1854874 (+) | 465 | WP_367122815.1 | ImmA/IrrE family metallo-endopeptidase | - |
| V6D01_RS09065 (V6D01_09045) | - | 1854884..1855561 (+) | 678 | WP_367122816.1 | hypothetical protein | - |
| V6D01_RS09070 (V6D01_09050) | - | 1855705..1855917 (+) | 213 | WP_367081037.1 | hypothetical protein | - |
| V6D01_RS09075 (V6D01_09055) | - | 1856138..1857121 (+) | 984 | WP_367122817.1 | DUF3644 domain-containing protein | - |
| V6D01_RS09080 (V6D01_09060) | - | 1857297..1858358 (+) | 1062 | WP_367122818.1 | tyrosine-type recombinase/integrase | - |
| V6D01_RS09095 (V6D01_09075) | comK/comK1 | 1858870..1859445 (-) | 576 | WP_023350568.1 | competence protein ComK | Regulator |
Sequence
Protein
Download Length: 191 a.a. Molecular weight: 22722.82 Da Isoelectric Point: 9.5768
>NTDB_id=938149 V6D01_RS09095 WP_023350568.1 1858870..1859445(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365670]
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDNIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDNIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK
Nucleotide
Download Length: 576 bp
>NTDB_id=938149 V6D01_RS09095 WP_023350568.1 1858870..1859445(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365670]
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAAAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGCAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAACATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAAAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGCAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAACATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
76.064 |
98.429 |
0.749 |
| comK/comK1 | Staphylococcus aureus N315 |
76.064 |
98.429 |
0.749 |