Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   V6D01_RS07670 Genome accession   NZ_CP145244
Coordinates   1590070..1590942 (-) Length   290 a.a.
NCBI ID   WP_023350397.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1365670     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1544775..1608291 1590070..1590942 within 0


Gene organization within MGE regions


Location: 1544775..1608291
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6D01_RS07490 (V6D01_07470) recA 1546336..1547388 (-) 1053 WP_002437037.1 recombinase RecA Machinery gene
  V6D01_RS07495 (V6D01_07475) - 1547557..1548705 (-) 1149 WP_023350376.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  V6D01_RS07500 (V6D01_07480) pgsA 1548848..1549429 (-) 582 WP_023350377.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  V6D01_RS07505 (V6D01_07485) - 1549457..1549849 (-) 393 WP_002436354.1 helix-turn-helix domain-containing protein -
  V6D01_RS07510 (V6D01_07490) - 1549868..1550695 (-) 828 WP_002436330.1 YmfK family protein -
  V6D01_RS07515 (V6D01_07495) - 1550854..1551561 (-) 708 WP_023350378.1 SDR family NAD(P)-dependent oxidoreductase -
  V6D01_RS07520 (V6D01_07500) - 1551561..1552847 (-) 1287 WP_023350379.1 pitrilysin family protein -
  V6D01_RS07525 (V6D01_07505) - 1552847..1554121 (-) 1275 WP_023350380.1 pitrilysin family protein -
  V6D01_RS07530 (V6D01_07510) - 1554163..1554873 (-) 711 WP_145387664.1 GntR family transcriptional regulator -
  V6D01_RS07535 (V6D01_07515) - 1554876..1557296 (-) 2421 WP_023350382.1 DNA translocase FtsK -
  V6D01_RS07540 (V6D01_07520) - 1557554..1559227 (-) 1674 WP_367122746.1 ribonuclease J -
  V6D01_RS07545 (V6D01_07525) pnp 1559461..1561560 (-) 2100 WP_023350384.1 polyribonucleotide nucleotidyltransferase -
  V6D01_RS07550 (V6D01_07530) rpsO 1561694..1561963 (-) 270 WP_002436359.1 30S ribosomal protein S15 -
  V6D01_RS07555 (V6D01_07535) ribF 1562085..1563056 (-) 972 WP_367122747.1 riboflavin biosynthesis protein RibF -
  V6D01_RS07560 (V6D01_07540) truB 1563072..1563989 (-) 918 WP_367122748.1 tRNA pseudouridine(55) synthase TruB -
  V6D01_RS07565 (V6D01_07545) rbfA 1564138..1564488 (-) 351 WP_002436301.1 30S ribosome-binding factor RbfA -
  V6D01_RS07570 (V6D01_07550) infB 1564645..1566819 (-) 2175 WP_023350386.1 translation initiation factor IF-2 -
  V6D01_RS07575 (V6D01_07555) - 1566824..1567141 (-) 318 WP_367122749.1 L7Ae/L30e/S12e/Gadd45 family ribosomal protein -
  V6D01_RS07580 (V6D01_07560) - 1567138..1567422 (-) 285 WP_002436310.1 YlxR family protein -
  V6D01_RS07585 (V6D01_07565) nusA 1567439..1568662 (-) 1224 WP_002436342.1 transcription termination factor NusA -
  V6D01_RS07590 (V6D01_07570) rimP 1568683..1569150 (-) 468 WP_002436317.1 ribosome maturation factor RimP -
  V6D01_RS07595 (V6D01_07575) - 1569375..1573685 (-) 4311 WP_087671603.1 PolC-type DNA polymerase III -
  V6D01_RS07600 (V6D01_07580) - 1573941..1575644 (-) 1704 WP_049326556.1 proline--tRNA ligase -
  V6D01_RS07605 (V6D01_07585) rseP 1575664..1576950 (-) 1287 WP_367122750.1 RIP metalloprotease RseP -
  V6D01_RS07610 (V6D01_07590) - 1577190..1577972 (-) 783 WP_002436308.1 phosphatidate cytidylyltransferase -
  V6D01_RS07615 (V6D01_07595) - 1577976..1578746 (-) 771 WP_023350390.1 isoprenyl transferase -
  V6D01_RS07620 (V6D01_07600) frr 1579027..1579581 (-) 555 WP_002436295.1 ribosome recycling factor -
  V6D01_RS07625 (V6D01_07605) pyrH 1579598..1580320 (-) 723 WP_002436299.1 UMP kinase -
  V6D01_RS07630 (V6D01_07610) tsf 1580457..1581335 (-) 879 WP_030064793.1 translation elongation factor Ts -
  V6D01_RS07635 (V6D01_07615) rpsB 1581486..1582274 (-) 789 WP_002436327.1 30S ribosomal protein S2 -
  V6D01_RS07640 (V6D01_07620) codY 1582528..1583301 (-) 774 WP_002436324.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  V6D01_RS07645 (V6D01_07625) hslU 1583324..1584727 (-) 1404 WP_367122751.1 ATP-dependent protease ATPase subunit HslU -
  V6D01_RS07650 (V6D01_07630) hslV 1584811..1585353 (-) 543 WP_023350393.1 ATP-dependent protease subunit HslV -
  V6D01_RS07655 (V6D01_07635) xerC 1585357..1586247 (-) 891 WP_023350394.1 tyrosine recombinase XerC -
  V6D01_RS07660 (V6D01_07640) trmFO 1586484..1587791 (-) 1308 WP_023350395.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  V6D01_RS07665 (V6D01_07645) topA 1587817..1589892 (-) 2076 WP_030064789.1 type I DNA topoisomerase -
  V6D01_RS07670 (V6D01_07650) dprA 1590070..1590942 (-) 873 WP_023350397.1 DNA-processing protein DprA Machinery gene
  V6D01_RS07675 (V6D01_07655) sucD 1591168..1592076 (-) 909 WP_002436344.1 succinate--CoA ligase subunit alpha -
  V6D01_RS07680 (V6D01_07660) sucC 1592098..1593264 (-) 1167 WP_002436291.1 ADP-forming succinate--CoA ligase subunit beta -
  V6D01_RS07685 (V6D01_07665) - 1593372..1594142 (-) 771 WP_023350398.1 ribonuclease HII -
  V6D01_RS07690 (V6D01_07670) ylqF 1594126..1595009 (-) 884 Protein_1455 ribosome biogenesis GTPase YlqF -
  V6D01_RS07695 (V6D01_07675) - 1595289..1597889 (+) 2601 WP_023350400.1 YfhO family protein -
  V6D01_RS07700 (V6D01_07680) - 1597882..1600488 (+) 2607 WP_023350401.1 YfhO family protein -
  V6D01_RS07705 (V6D01_07685) - 1600968..1601174 (+) 207 WP_226859621.1 hypothetical protein -
  V6D01_RS07710 (V6D01_07690) - 1601214..1601552 (+) 339 WP_023350404.1 hypothetical protein -
  V6D01_RS07715 (V6D01_07695) rplS 1602129..1602479 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  V6D01_RS07720 (V6D01_07700) trmD 1602585..1603322 (-) 738 WP_023350405.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  V6D01_RS07725 (V6D01_07705) rimM 1603322..1603825 (-) 504 WP_023350406.1 ribosome maturation factor RimM -
  V6D01_RS07730 (V6D01_07710) rpsP 1604088..1604363 (-) 276 WP_367122752.1 30S ribosomal protein S16 -
  V6D01_RS07735 (V6D01_07715) ffh 1604791..1606158 (-) 1368 WP_002435148.1 signal recognition particle protein -
  V6D01_RS07740 (V6D01_07720) - 1606188..1606520 (-) 333 WP_002435170.1 putative DNA-binding protein -
  V6D01_RS07745 (V6D01_07725) ftsY 1606507..1607766 (-) 1260 WP_367122753.1 signal recognition particle-docking protein FtsY -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33411.79 Da        Isoelectric Point: 9.7513

>NTDB_id=938147 V6D01_RS07670 WP_023350397.1 1590070..1590942(-) (dprA) [Staphylococcus capitis subsp. urealyticus strain Sc1365670]
MIQHTLLKLYWANFATTQVHQFIKEYPEVISENALIQNKMIEDWAKRQTSSTVRRKLSLFKSLNTEVIFQEMTKMNLKYL
TYFDKHYPQLLKEIYDFPYVIFYKGNKQLFNCPHTLAVIGSRKSTLYTTQALEYLFPSFKSLKMTIISGLAYGADSIAHQ
VALKNKLPTIGVLGFGHSYHYPKSSLKTRENIERKGLVISEYPPHSPITRYKFPERNRLISGLARGLLITEAEKISGSQI
TVDCALEQNRNVYVLPGSMFNPMTKSNLLRLQEGAQVVLDECSILSDYIF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=938147 V6D01_RS07670 WP_023350397.1 1590070..1590942(-) (dprA) [Staphylococcus capitis subsp. urealyticus strain Sc1365670]
GTGATTCAACACACTTTATTGAAGCTCTATTGGGCTAATTTCGCCACAACGCAAGTTCATCAATTTATTAAAGAATATCC
AGAAGTTATTTCAGAAAACGCACTAATTCAAAATAAGATGATTGAGGATTGGGCTAAAAGACAAACCTCATCCACAGTCA
GGAGAAAATTGAGCTTATTTAAATCACTTAATACAGAAGTTATATTTCAAGAAATGACTAAAATGAACCTCAAATATTTA
ACTTACTTTGATAAACATTATCCTCAATTACTTAAAGAAATTTATGATTTCCCATATGTAATTTTTTATAAAGGAAATAA
ACAACTATTTAATTGTCCTCATACTTTAGCTGTTATAGGCTCAAGAAAGTCAACCTTATATACAACTCAAGCTTTGGAAT
ATCTTTTCCCATCATTTAAATCACTAAAAATGACGATTATTTCAGGATTAGCATATGGTGCAGATAGTATAGCTCACCAA
GTCGCACTAAAAAATAAACTTCCAACAATAGGCGTTCTTGGCTTCGGCCATTCATATCATTATCCTAAATCATCTTTAAA
GACAAGAGAGAATATCGAACGAAAAGGACTAGTTATAAGTGAGTATCCACCTCATTCTCCCATAACCAGATATAAATTTC
CTGAAAGAAATAGATTGATTAGTGGACTCGCTCGGGGTCTATTAATTACAGAAGCAGAGAAAATAAGCGGTAGTCAAATA
ACAGTAGACTGCGCTTTAGAACAAAACCGGAATGTATATGTTTTACCAGGATCAATGTTTAATCCTATGACCAAAAGTAA
TTTACTTAGACTTCAAGAGGGGGCACAAGTCGTTTTAGATGAATGTAGTATTCTTTCAGACTACATTTTCTAA

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

59.028

99.31

0.586
  dprA Staphylococcus aureus MW2

59.028

99.31

0.586