Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   V6C70_RS09970 Genome accession   NZ_CP145235
Coordinates   1982140..1982715 (-) Length   191 a.a.
NCBI ID   WP_023350568.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1365688     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1935917..1981628 1982140..1982715 flank 512


Gene organization within MGE regions


Location: 1935917..1982715
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6C70_RS09595 (V6C70_09575) - 1935917..1936114 (-) 198 WP_023350503.1 hypothetical protein -
  V6C70_RS09600 (V6C70_09580) - 1937064..1937249 (-) 186 WP_023350504.1 hypothetical protein -
  V6C70_RS09605 (V6C70_09585) - 1937251..1937361 (-) 111 WP_049307399.1 hypothetical protein -
  V6C70_RS09610 (V6C70_09590) - 1937432..1937583 (-) 152 Protein_1809 hypothetical protein -
  V6C70_RS09615 (V6C70_09595) - 1937730..1939193 (-) 1464 WP_023350505.1 SH3 domain-containing protein -
  V6C70_RS09620 (V6C70_09600) - 1939168..1939578 (-) 411 WP_023350506.1 phage holin -
  V6C70_RS09625 (V6C70_09605) - 1939623..1940156 (-) 534 WP_023350507.1 hypothetical protein -
  V6C70_RS09630 (V6C70_09610) - 1940156..1940671 (-) 516 WP_023350508.1 hypothetical protein -
  V6C70_RS09635 (V6C70_09615) - 1940713..1940859 (-) 147 WP_023350509.1 XkdX family protein -
  V6C70_RS09640 (V6C70_09620) - 1940852..1941196 (-) 345 WP_023350510.1 hypothetical protein -
  V6C70_RS09645 (V6C70_09625) - 1941208..1942866 (-) 1659 WP_023350511.1 BppU family phage baseplate upper protein -
  V6C70_RS09650 (V6C70_09630) - 1942919..1944121 (-) 1203 WP_023350512.1 N-acetylglucosaminidase -
  V6C70_RS09655 (V6C70_09635) - 1944770..1945006 (-) 237 Protein_1818 CHAP domain-containing protein -
  V6C70_RS09660 (V6C70_09640) - 1945321..1945452 (-) 132 WP_023350514.1 hypothetical protein -
  V6C70_RS09665 (V6C70_09645) - 1945506..1945904 (-) 399 WP_037560594.1 hypothetical protein -
  V6C70_RS09670 (V6C70_09650) - 1945885..1946307 (-) 423 WP_023350516.1 hypothetical protein -
  V6C70_RS09675 (V6C70_09655) - 1946321..1947508 (-) 1188 WP_023350517.1 BppU family phage baseplate upper protein -
  V6C70_RS09680 (V6C70_09660) - 1947521..1949407 (-) 1887 WP_023350518.1 M14 family metallopeptidase -
  V6C70_RS09685 (V6C70_09665) - 1949410..1950870 (-) 1461 WP_023350519.1 phage tail protein -
  V6C70_RS09690 (V6C70_09670) - 1950882..1951838 (-) 957 WP_023350520.1 phage tail domain-containing protein -
  V6C70_RS09695 (V6C70_09675) - 1951850..1955779 (-) 3930 WP_023350521.1 TMP repeat protein -
  V6C70_RS09700 (V6C70_09680) - 1955794..1956138 (-) 345 WP_023350522.1 hypothetical protein -
  V6C70_RS09705 (V6C70_09685) - 1956180..1956539 (-) 360 WP_023350523.1 tail assembly chaperone -
  V6C70_RS09710 (V6C70_09690) - 1956602..1957156 (-) 555 WP_002436441.1 phage major tail protein, TP901-1 family -
  V6C70_RS09715 (V6C70_09695) - 1957203..1957592 (-) 390 WP_023350524.1 hypothetical protein -
  V6C70_RS09720 (V6C70_09700) - 1957886..1958572 (-) 687 WP_023350525.1 hypothetical protein -
  V6C70_RS09725 (V6C70_09705) - 1958696..1958944 (-) 249 Protein_1832 hypothetical protein -
  V6C70_RS09730 (V6C70_09710) - 1958944..1959246 (-) 303 WP_023350527.1 hypothetical protein -
  V6C70_RS09735 (V6C70_09715) - 1959243..1959572 (-) 330 WP_002436519.1 phage head-tail connector protein -
  V6C70_RS09740 (V6C70_09720) - 1959574..1959843 (-) 270 WP_023350528.1 hypothetical protein -
  V6C70_RS09745 (V6C70_09725) - 1959866..1960780 (-) 915 WP_023350529.1 phage major capsid protein -
  V6C70_RS09750 (V6C70_09730) - 1960797..1961411 (-) 615 WP_023350530.1 DUF4355 domain-containing protein -
  V6C70_RS09755 (V6C70_09735) - 1961664..1961807 (-) 144 WP_002436512.1 hypothetical protein -
  V6C70_RS09760 (V6C70_09740) - 1961800..1962345 (-) 546 WP_023350531.1 hypothetical protein -
  V6C70_RS09765 (V6C70_09745) - 1962365..1963315 (-) 951 Protein_1840 minor capsid protein -
  V6C70_RS09770 (V6C70_09750) - 1963322..1964818 (-) 1497 WP_023350534.1 phage portal protein -
  V6C70_RS09775 (V6C70_09755) - 1964832..1966124 (-) 1293 WP_023350535.1 PBSX family phage terminase large subunit -
  V6C70_RS09780 (V6C70_09760) - 1966117..1966458 (-) 342 WP_023350536.1 phBC6A51 family helix-turn-helix protein -
  V6C70_RS09785 (V6C70_09765) - 1966736..1967152 (-) 417 WP_002436508.1 hypothetical protein -
  V6C70_RS09790 (V6C70_09770) - 1967223..1967393 (-) 171 WP_002469957.1 hypothetical protein -
  V6C70_RS09795 (V6C70_09775) - 1967399..1967539 (-) 141 WP_002475527.1 DUF1381 domain-containing protein -
  V6C70_RS09800 (V6C70_09780) - 1967541..1967717 (-) 177 WP_023350538.1 hypothetical protein -
  V6C70_RS09805 (V6C70_09785) dut 1967754..1968179 (-) 426 WP_023350540.1 dUTP diphosphatase -
  V6C70_RS09810 (V6C70_09790) - 1968181..1968378 (-) 198 WP_023350541.1 hypothetical protein -
  V6C70_RS09815 (V6C70_09795) - 1968362..1968916 (-) 555 WP_023350542.1 nucleoside 2-deoxyribosyltransferase -
  V6C70_RS09820 (V6C70_09800) - 1968919..1969116 (-) 198 WP_023350543.1 hypothetical protein -
  V6C70_RS09825 (V6C70_09805) - 1969117..1969464 (-) 348 WP_367009776.1 SA1788 family PVL leukocidin-associated protein -
  V6C70_RS09830 (V6C70_09810) - 1969465..1969656 (-) 192 WP_023350545.1 hypothetical protein -
  V6C70_RS09835 (V6C70_09815) - 1969646..1970056 (-) 411 WP_023350546.1 DUF1064 domain-containing protein -
  V6C70_RS09840 (V6C70_09820) - 1970065..1970310 (-) 246 WP_002469995.1 DUF3269 family protein -
  V6C70_RS09845 (V6C70_09825) - 1970313..1970468 (-) 156 WP_002469952.1 hypothetical protein -
  V6C70_RS09850 (V6C70_09830) - 1970462..1971223 (-) 762 WP_227707438.1 ATP-binding protein -
  V6C70_RS09855 (V6C70_09835) - 1971243..1971998 (-) 756 WP_037560596.1 conserved phage C-terminal domain-containing protein -
  V6C70_RS09860 (V6C70_09840) - 1971985..1972665 (-) 681 WP_023350548.1 putative HNHc nuclease -
  V6C70_RS09865 (V6C70_09845) ssbA 1972679..1973092 (-) 414 WP_023350549.1 single-stranded DNA-binding protein Machinery gene
  V6C70_RS09870 (V6C70_09850) - 1973085..1973738 (-) 654 WP_023350550.1 ERF family protein -
  V6C70_RS09875 (V6C70_09855) - 1973731..1973952 (-) 222 WP_023350551.1 DUF2483 family protein -
  V6C70_RS09880 (V6C70_09860) - 1973918..1974199 (-) 282 WP_367009777.1 chordopoxvirus fusion protein -
  V6C70_RS09885 (V6C70_09865) - 1974221..1974439 (-) 219 WP_023350553.1 hypothetical protein -
  V6C70_RS09890 (V6C70_09870) - 1974917..1975129 (-) 213 WP_002436465.1 DUF771 domain-containing protein -
  V6C70_RS09895 (V6C70_09875) - 1975133..1975300 (-) 168 WP_023350555.1 hypothetical protein -
  V6C70_RS09900 (V6C70_09880) - 1975402..1975596 (-) 195 WP_023350556.1 hypothetical protein -
  V6C70_RS09905 (V6C70_09885) - 1975679..1975855 (+) 177 WP_023350557.1 hypothetical protein -
  V6C70_RS09910 (V6C70_09890) - 1975881..1975979 (-) 99 Protein_1869 hypothetical protein -
  V6C70_RS09915 (V6C70_09895) - 1976069..1976245 (-) 177 WP_023350559.1 hypothetical protein -
  V6C70_RS09920 (V6C70_09900) - 1976328..1977098 (-) 771 WP_023350560.1 DUF6551 family protein -
  V6C70_RS09925 (V6C70_09905) - 1977095..1978051 (-) 957 WP_049307539.1 ParB N-terminal domain-containing protein -
  V6C70_RS09930 (V6C70_09910) - 1978067..1978306 (-) 240 WP_023350563.1 helix-turn-helix transcriptional regulator -
  V6C70_RS09935 (V6C70_09915) - 1978500..1978829 (+) 330 WP_002469947.1 helix-turn-helix transcriptional regulator -
  V6C70_RS09940 (V6C70_09920) - 1978841..1979302 (+) 462 WP_023350564.1 ImmA/IrrE family metallo-endopeptidase -
  V6C70_RS09945 (V6C70_09925) - 1979321..1979845 (+) 525 WP_023350565.1 Ltp family lipoprotein -
  V6C70_RS09950 (V6C70_09930) - 1979860..1980507 (+) 648 WP_023350566.1 hypothetical protein -
  V6C70_RS09955 (V6C70_09935) - 1980567..1981628 (+) 1062 WP_023350567.1 tyrosine-type recombinase/integrase -
  V6C70_RS09970 (V6C70_09950) comK/comK1 1982140..1982715 (-) 576 WP_023350568.1 competence protein ComK Regulator

Sequence


Protein


Download         Length: 191 a.a.        Molecular weight: 22722.82 Da        Isoelectric Point: 9.5768

>NTDB_id=938016 V6C70_RS09970 WP_023350568.1 1982140..1982715(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365688]
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDNIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK

Nucleotide


Download         Length: 576 bp        

>NTDB_id=938016 V6C70_RS09970 WP_023350568.1 1982140..1982715(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365688]
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAAAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGCAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAACATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG

Domains


Predicted by InterproScan.

(8-157)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.064

98.429

0.749

  comK/comK1 Staphylococcus aureus N315

76.064

98.429

0.749