Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   V6C75_RS09175 Genome accession   NZ_CP145221
Coordinates   1914499..1915074 (-) Length   191 a.a.
NCBI ID   WP_002433165.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1365706     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1866407..1913992 1914499..1915074 flank 507


Gene organization within MGE regions


Location: 1866407..1915074
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6C75_RS08835 - 1866407..1867078 (+) 672 WP_047796099.1 Ltp family lipoprotein -
  V6C75_RS08840 - 1867685..1868212 (+) 528 WP_030065136.1 Ltp family lipoprotein -
  V6C75_RS08845 - 1868927..1869124 (-) 198 WP_023350503.1 hypothetical protein -
  V6C75_RS08850 - 1870074..1870259 (-) 186 WP_037579389.1 XRE family transcriptional regulator -
  V6C75_RS08855 - 1870261..1870371 (-) 111 WP_087671645.1 hypothetical protein -
  V6C75_RS08860 - 1870742..1872205 (-) 1464 WP_367080993.1 SH3 domain-containing protein -
  V6C75_RS08865 - 1872180..1872590 (-) 411 WP_325957166.1 phage holin -
  V6C75_RS08870 - 1872649..1874124 (-) 1476 WP_325957168.1 SGNH/GDSL hydrolase family protein -
  V6C75_RS08875 - 1874171..1874317 (-) 147 WP_002469988.1 XkdX family protein -
  V6C75_RS08880 - 1874310..1874654 (-) 345 WP_002469970.1 hypothetical protein -
  V6C75_RS08885 - 1874666..1876324 (-) 1659 WP_325957171.1 BppU family phage baseplate upper protein -
  V6C75_RS08890 - 1876377..1878257 (-) 1881 WP_367080995.1 glucosaminidase domain-containing protein -
  V6C75_RS08895 - 1878311..1878709 (-) 399 WP_367080996.1 hypothetical protein -
  V6C75_RS08900 - 1878690..1879112 (-) 423 WP_002470002.1 hypothetical protein -
  V6C75_RS08905 - 1879126..1880313 (-) 1188 WP_367080997.1 BppU family phage baseplate upper protein -
  V6C75_RS08910 - 1880326..1882212 (-) 1887 WP_367080998.1 M14 family metallopeptidase -
  V6C75_RS08915 - 1882215..1883675 (-) 1461 WP_340762173.1 phage tail protein -
  V6C75_RS08920 - 1883687..1884643 (-) 957 WP_367081000.1 phage tail domain-containing protein -
  V6C75_RS08925 - 1884655..1888584 (-) 3930 WP_367081002.1 phage tail protein -
  V6C75_RS08930 - 1888599..1888943 (-) 345 WP_367081004.1 hypothetical protein -
  V6C75_RS08935 - 1888985..1889344 (-) 360 WP_098905461.1 tail assembly chaperone -
  V6C75_RS08940 - 1889406..1889960 (-) 555 WP_002436441.1 phage major tail protein, TP901-1 family -
  V6C75_RS08945 - 1890007..1890396 (-) 390 WP_367081005.1 hypothetical protein -
  V6C75_RS08950 - 1890407..1890766 (-) 360 WP_002469983.1 HK97-gp10 family putative phage morphogenesis protein -
  V6C75_RS08955 - 1890766..1891068 (-) 303 WP_367081007.1 hypothetical protein -
  V6C75_RS08960 - 1891065..1891394 (-) 330 WP_002436519.1 phage head-tail connector protein -
  V6C75_RS08965 - 1891396..1891665 (-) 270 WP_367081008.1 hypothetical protein -
  V6C75_RS08970 - 1891688..1892602 (-) 915 WP_058121718.1 phage major capsid protein -
  V6C75_RS08975 - 1892618..1893232 (-) 615 WP_367081009.1 DUF4355 domain-containing protein -
  V6C75_RS08980 - 1893485..1893628 (-) 144 WP_367081010.1 hypothetical protein -
  V6C75_RS08985 - 1893621..1894166 (-) 546 WP_367081012.1 hypothetical protein -
  V6C75_RS08990 - 1894186..1895136 (-) 951 WP_367081013.1 minor capsid protein -
  V6C75_RS08995 - 1895143..1896639 (-) 1497 WP_367081015.1 phage portal protein -
  V6C75_RS09000 - 1896653..1897933 (-) 1281 WP_367081017.1 PBSX family phage terminase large subunit -
  V6C75_RS09005 - 1897920..1898357 (-) 438 WP_037579395.1 terminase small subunit -
  V6C75_RS09010 - 1898615..1899031 (-) 417 WP_002436508.1 hypothetical protein -
  V6C75_RS09015 rinB 1899102..1899272 (-) 171 WP_367081019.1 transcriptional activator RinB -
  V6C75_RS09020 dut 1899321..1899746 (-) 426 WP_367081021.1 dUTP diphosphatase -
  V6C75_RS09025 - 1899763..1899921 (-) 159 WP_367081022.1 hypothetical protein -
  V6C75_RS09030 - 1899924..1900121 (-) 198 WP_367081023.1 hypothetical protein -
  V6C75_RS09035 - 1900122..1900469 (-) 348 WP_367081024.1 SA1788 family PVL leukocidin-associated protein -
  V6C75_RS09040 - 1900470..1900655 (-) 186 WP_411757059.1 hypothetical protein -
  V6C75_RS09045 - 1900802..1901110 (-) 309 WP_002469777.1 VRR-NUC domain-containing protein -
  V6C75_RS09050 - 1901107..1901310 (-) 204 WP_030058927.1 pathogenicity island protein -
  V6C75_RS09055 - 1901612..1903918 (-) 2307 WP_367081025.1 phage/plasmid primase, P4 family -
  V6C75_RS09060 - 1903969..1904469 (-) 501 WP_030058925.1 DUF669 domain-containing protein -
  V6C75_RS09065 - 1904489..1904905 (-) 417 WP_411757051.1 hypothetical protein -
  V6C75_RS09070 - 1904957..1905307 (-) 351 Protein_1753 DEAD/DEAH box helicase -
  V6C75_RS09075 - 1905328..1905825 (-) 498 WP_411757052.1 DEAD/DEAH box helicase -
  V6C75_RS09080 - 1905809..1906513 (-) 705 WP_367081029.1 AAA family ATPase -
  V6C75_RS09085 - 1906514..1906999 (-) 486 WP_367081030.1 siphovirus Gp157 family protein -
  V6C75_RS09090 - 1906992..1907246 (-) 255 WP_367081031.1 chordopoxvirus fusion protein -
  V6C75_RS09095 - 1907268..1907480 (-) 213 WP_141489380.1 hypothetical protein -
  V6C75_RS09100 - 1907620..1908084 (+) 465 WP_367081032.1 hypothetical protein -
  V6C75_RS09105 - 1908167..1908316 (-) 150 WP_411757053.1 hypothetical protein -
  V6C75_RS09110 - 1908328..1908540 (-) 213 WP_213606272.1 DUF771 domain-containing protein -
  V6C75_RS09115 - 1908542..1908706 (-) 165 WP_176746971.1 hypothetical protein -
  V6C75_RS09120 - 1908766..1908975 (+) 210 WP_367081033.1 hypothetical protein -
  V6C75_RS09125 - 1908965..1909108 (-) 144 WP_168995378.1 hypothetical protein -
  V6C75_RS09130 - 1909383..1909604 (-) 222 WP_367081034.1 hypothetical protein -
  V6C75_RS09135 - 1909618..1909878 (-) 261 WP_367081035.1 helix-turn-helix transcriptional regulator -
  V6C75_RS09140 - 1910070..1910708 (+) 639 WP_237640681.1 S24 family peptidase -
  V6C75_RS09145 - 1910815..1911027 (+) 213 WP_367081037.1 hypothetical protein -
  V6C75_RS09150 - 1911313..1911843 (+) 531 WP_153907026.1 Bsp6I family type II restriction endonuclease -
  V6C75_RS09155 - 1911906..1912874 (+) 969 WP_367081038.1 DNA cytosine methyltransferase -
  V6C75_RS09160 - 1912931..1913992 (+) 1062 WP_337225422.1 tyrosine-type recombinase/integrase -
  V6C75_RS09175 comK/comK1 1914499..1915074 (-) 576 WP_002433165.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22695.79 Da        Isoelectric Point: 9.5768

>NTDB_id=937907 V6C75_RS09175 WP_002433165.1 1914499..1915074(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365706]
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDSIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK

Nucleotide


Download         Length: 576 bp        

>NTDB_id=937907 V6C75_RS09175 WP_002433165.1 1914499..1915074(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365706]
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAGAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGTAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAGCATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(8-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.596

98.429

0.754
  comK/comK1 Staphylococcus aureus N315

76.596

98.429

0.754