Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   V6C87_RS09325 Genome accession   NZ_CP145214
Coordinates   1863491..1864066 (-) Length   191 a.a.
NCBI ID   WP_367008553.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1365754     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1819355..1863087 1863491..1864066 flank 404


Gene organization within MGE regions


Location: 1819355..1864066
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6C87_RS08975 (V6C87_08980) - 1819355..1820026 (+) 672 WP_367008529.1 Ltp family lipoprotein -
  V6C87_RS08980 (V6C87_08985) - 1820184..1820354 (-) 171 WP_241497408.1 hypothetical protein -
  V6C87_RS08985 (V6C87_08990) - 1820874..1821062 (-) 189 WP_367008530.1 hypothetical protein -
  V6C87_RS08990 (V6C87_08995) - 1821322..1821492 (+) 171 Protein_1668 site-specific integrase -
  V6C87_RS08995 (V6C87_09000) - 1822386..1822583 (-) 198 WP_081253920.1 hypothetical protein -
  V6C87_RS09000 (V6C87_09005) - 1822773..1822904 (-) 132 WP_259978902.1 hypothetical protein -
  V6C87_RS09005 (V6C87_09010) - 1823075..1824538 (-) 1464 WP_070840838.1 SH3 domain-containing protein -
  V6C87_RS09010 (V6C87_09015) - 1824513..1824923 (-) 411 WP_367008531.1 phage holin -
  V6C87_RS09015 (V6C87_09020) - 1824987..1825133 (-) 147 WP_070840836.1 XkdX family protein -
  V6C87_RS09020 (V6C87_09025) - 1825126..1825470 (-) 345 WP_070840835.1 hypothetical protein -
  V6C87_RS09025 (V6C87_09030) - 1825484..1826536 (-) 1053 WP_070840834.1 BppU family phage baseplate upper protein -
  V6C87_RS09030 (V6C87_09035) - 1826637..1827044 (-) 408 WP_070840833.1 hypothetical protein -
  V6C87_RS09035 (V6C87_09040) - 1827031..1827456 (-) 426 WP_002468158.1 hypothetical protein -
  V6C87_RS09040 (V6C87_09045) - 1827453..1828076 (-) 624 WP_070840840.1 poly-gamma-glutamate hydrolase family protein -
  V6C87_RS09045 (V6C87_09050) - 1828081..1829295 (-) 1215 WP_367008532.1 BppU family phage baseplate upper protein -
  V6C87_RS09050 (V6C87_09055) - 1829295..1831157 (-) 1863 WP_367008533.1 M14 family metallopeptidase -
  V6C87_RS09055 (V6C87_09060) - 1831173..1831346 (-) 174 WP_002453517.1 hypothetical protein -
  V6C87_RS09060 (V6C87_09065) - 1831339..1832898 (-) 1560 WP_367008534.1 prophage endopeptidase tail family protein -
  V6C87_RS09065 (V6C87_09070) - 1832908..1833741 (-) 834 WP_070840829.1 phage tail domain-containing protein -
  V6C87_RS09070 (V6C87_09075) - 1833743..1838635 (-) 4893 WP_367008535.1 phage tail tape measure protein -
  V6C87_RS09075 (V6C87_09080) - 1838664..1838816 (-) 153 WP_002503474.1 hypothetical protein -
  V6C87_RS09080 (V6C87_09085) - 1838849..1839211 (-) 363 WP_337225400.1 hypothetical protein -
  V6C87_RS09085 (V6C87_09090) - 1839275..1839460 (-) 186 WP_337225401.1 hypothetical protein -
  V6C87_RS09090 (V6C87_09095) - 1839479..1840108 (-) 630 WP_049401376.1 major tail protein -
  V6C87_RS09095 (V6C87_09100) - 1840171..1840707 (-) 537 WP_002488925.1 HNH endonuclease -
  V6C87_RS09100 (V6C87_09105) - 1840721..1841122 (-) 402 WP_259978888.1 hypothetical protein -
  V6C87_RS09105 (V6C87_09110) - 1841127..1841393 (-) 267 WP_002453526.1 hypothetical protein -
  V6C87_RS09110 (V6C87_09115) - 1841528..1841857 (-) 330 WP_002453527.1 head-tail adaptor protein -
  V6C87_RS09115 (V6C87_09120) - 1841847..1842188 (-) 342 WP_016064949.1 head-tail connector protein -
  V6C87_RS09120 (V6C87_09125) - 1842207..1843565 (-) 1359 WP_367008536.1 phage major capsid protein -
  V6C87_RS09125 (V6C87_09130) - 1843606..1844163 (-) 558 WP_367008537.1 HK97 family phage prohead protease -
  V6C87_RS09130 (V6C87_09135) - 1844153..1845385 (-) 1233 WP_367008538.1 phage portal protein -
  V6C87_RS09135 (V6C87_09140) - 1845388..1845582 (-) 195 WP_367008539.1 hypothetical protein -
  V6C87_RS09140 (V6C87_09145) - 1845594..1847345 (-) 1752 WP_367008540.1 terminase TerL endonuclease subunit -
  V6C87_RS09145 (V6C87_09150) - 1847338..1847808 (-) 471 WP_002504173.1 phage terminase small subunit P27 family -
  V6C87_RS09150 (V6C87_09155) - 1847954..1848316 (-) 363 WP_070840819.1 HNH endonuclease signature motif containing protein -
  V6C87_RS09155 (V6C87_09160) - 1848931..1849377 (-) 447 WP_016064941.1 hypothetical protein -
  V6C87_RS09160 (V6C87_09165) - 1849394..1849543 (-) 150 WP_002456391.1 DUF1514 domain-containing protein -
  V6C87_RS09165 (V6C87_09170) - 1849544..1849726 (-) 183 WP_070840818.1 regulator -
  V6C87_RS09170 (V6C87_09175) dut 1849775..1850200 (-) 426 WP_064210306.1 dUTP diphosphatase -
  V6C87_RS09175 (V6C87_09180) - 1850203..1850346 (-) 144 WP_169922987.1 hypothetical protein -
  V6C87_RS09180 (V6C87_09185) - 1850343..1850822 (-) 480 WP_367008541.1 nucleoside 2-deoxyribosyltransferase -
  V6C87_RS09185 (V6C87_09190) - 1851023..1851388 (-) 366 WP_367008542.1 SA1788 family PVL leukocidin-associated protein -
  V6C87_RS09190 (V6C87_09195) - 1851389..1851583 (-) 195 WP_367008543.1 hypothetical protein -
  V6C87_RS09195 (V6C87_09200) - 1851576..1851983 (-) 408 WP_016064931.1 DUF1064 domain-containing protein -
  V6C87_RS09200 (V6C87_09205) - 1851992..1852237 (-) 246 WP_064210313.1 hypothetical protein -
  V6C87_RS09205 (V6C87_09210) - 1852240..1852395 (-) 156 WP_037549689.1 hypothetical protein -
  V6C87_RS09210 (V6C87_09215) - 1852389..1853150 (-) 762 WP_367009362.1 ATP-binding protein -
  V6C87_RS09215 (V6C87_09220) - 1853172..1853951 (-) 780 WP_367008544.1 conserved phage C-terminal domain-containing protein -
  V6C87_RS09220 (V6C87_09225) - 1853944..1854714 (-) 771 WP_237637374.1 AP2 domain-containing protein -
  V6C87_RS09225 (V6C87_09230) - 1854720..1854950 (-) 231 WP_367008545.1 helix-turn-helix transcriptional regulator -
  V6C87_RS09230 (V6C87_09235) - 1854928..1855617 (-) 690 WP_367008546.1 putative HNHc nuclease -
  V6C87_RS09235 (V6C87_09240) - 1855632..1856159 (-) 528 WP_064210319.1 hypothetical protein -
  V6C87_RS09240 (V6C87_09245) - 1856188..1856964 (-) 777 WP_367008547.1 ATP-binding protein -
  V6C87_RS09245 (V6C87_09250) - 1856957..1857181 (-) 225 WP_367008548.1 DUF2483 family protein -
  V6C87_RS09250 (V6C87_09255) - 1857153..1857428 (-) 276 WP_367008549.1 chordopoxvirus fusion protein -
  V6C87_RS09255 (V6C87_09260) - 1857450..1857668 (-) 219 WP_168995386.1 hypothetical protein -
  V6C87_RS09260 (V6C87_09265) - 1857682..1857891 (-) 210 WP_002469786.1 hypothetical protein -
  V6C87_RS09265 (V6C87_09270) - 1857980..1858318 (+) 339 WP_037549728.1 hypothetical protein -
  V6C87_RS09270 (V6C87_09275) - 1858304..1858537 (-) 234 WP_030058915.1 MW1434 family type I TA system toxin -
  V6C87_RS09275 (V6C87_09280) - 1858549..1859319 (-) 771 WP_070487469.1 phage regulatory protein/antirepressor Ant -
  V6C87_RS09280 (V6C87_09285) - 1859333..1859569 (-) 237 WP_002500133.1 helix-turn-helix transcriptional regulator -
  V6C87_RS09285 (V6C87_09290) - 1859721..1860035 (+) 315 WP_110709103.1 helix-turn-helix transcriptional regulator -
  V6C87_RS09290 (V6C87_09295) - 1860047..1860511 (+) 465 WP_145424563.1 ImmA/IrrE family metallo-endopeptidase -
  V6C87_RS09295 (V6C87_09300) - 1860523..1861050 (+) 528 WP_145424565.1 Ltp family lipoprotein -
  V6C87_RS09300 (V6C87_09305) - 1861196..1861597 (+) 402 WP_367008550.1 sporulation protein -
  V6C87_RS09305 (V6C87_09310) - 1861654..1861977 (+) 324 WP_367008551.1 hypothetical protein -
  V6C87_RS09310 (V6C87_09315) - 1862038..1863087 (+) 1050 WP_367008552.1 tyrosine-type recombinase/integrase -
  V6C87_RS09325 (V6C87_09330) comK/comK1 1863491..1864066 (-) 576 WP_367008553.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22722.82 Da        Isoelectric Point: 9.5768

>NTDB_id=937803 V6C87_RS09325 WP_367008553.1 1863491..1864066(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365754]
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKENPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDSIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK

Nucleotide


Download         Length: 576 bp        

>NTDB_id=937803 V6C87_RS09325 WP_367008553.1 1863491..1864066(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1365754]
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAGAATCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGTAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTTCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAGCATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(8-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

77.128

98.429

0.759
  comK/comK1 Staphylococcus aureus N315

77.128

98.429

0.759