Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   V6C54_RS09005 Genome accession   NZ_CP145201
Coordinates   1878265..1878840 (-) Length   191 a.a.
NCBI ID   WP_002433165.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1516943     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1829399..1877758 1878265..1878840 flank 507


Gene organization within MGE regions


Location: 1829399..1878840
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6C54_RS08655 (V6C54_08665) - 1829399..1830070 (+) 672 WP_047796099.1 Ltp family lipoprotein -
  V6C54_RS08660 (V6C54_08670) - 1830677..1831204 (+) 528 WP_030065136.1 Ltp family lipoprotein -
  V6C54_RS08665 (V6C54_08675) - 1831917..1832114 (-) 198 WP_023350503.1 hypothetical protein -
  V6C54_RS08670 (V6C54_08680) - 1833092..1834555 (-) 1464 WP_047796098.1 SH3 domain-containing protein -
  V6C54_RS08675 (V6C54_08685) - 1834530..1834940 (-) 411 WP_047796097.1 phage holin -
  V6C54_RS08680 (V6C54_08690) - 1834984..1835517 (-) 534 WP_047796096.1 hypothetical protein -
  V6C54_RS08685 (V6C54_08695) - 1835517..1836032 (-) 516 WP_047796095.1 hypothetical protein -
  V6C54_RS08690 (V6C54_08700) - 1836073..1836219 (-) 147 WP_047796094.1 XkdX family protein -
  V6C54_RS08695 (V6C54_08705) - 1836212..1836550 (-) 339 WP_047796093.1 hypothetical protein -
  V6C54_RS08700 (V6C54_08710) - 1836562..1838220 (-) 1659 WP_047796092.1 BppU family phage baseplate upper protein -
  V6C54_RS08705 (V6C54_08715) - 1838273..1840081 (-) 1809 WP_080960916.1 glucosaminidase domain-containing protein -
  V6C54_RS08710 (V6C54_08720) - 1840158..1840775 (-) 618 WP_047796090.1 AP2 domain-containing protein -
  V6C54_RS08715 (V6C54_08725) - 1840996..1841127 (-) 132 WP_023350514.1 hypothetical protein -
  V6C54_RS08720 (V6C54_08730) - 1841181..1841579 (-) 399 WP_047796089.1 hypothetical protein -
  V6C54_RS08725 (V6C54_08735) - 1841560..1841982 (-) 423 WP_047796088.1 hypothetical protein -
  V6C54_RS08730 (V6C54_08740) - 1841996..1843183 (-) 1188 WP_047796087.1 BppU family phage baseplate upper protein -
  V6C54_RS08735 (V6C54_08745) - 1843196..1845082 (-) 1887 WP_047796086.1 M14 family metallopeptidase -
  V6C54_RS08740 (V6C54_08750) - 1845085..1846545 (-) 1461 WP_047796085.1 phage tail protein -
  V6C54_RS08745 (V6C54_08755) - 1846557..1847513 (-) 957 WP_047796084.1 phage tail domain-containing protein -
  V6C54_RS08750 (V6C54_08760) - 1847525..1851508 (-) 3984 WP_367009693.1 phage tail protein -
  V6C54_RS08755 (V6C54_08765) - 1851526..1851870 (-) 345 WP_047796082.1 hypothetical protein -
  V6C54_RS08760 (V6C54_08770) - 1851912..1852271 (-) 360 WP_047796081.1 tail assembly chaperone -
  V6C54_RS08765 (V6C54_08775) - 1852333..1852887 (-) 555 WP_047796080.1 phage major tail protein, TP901-1 family -
  V6C54_RS08770 (V6C54_08780) - 1852934..1853323 (-) 390 WP_047796079.1 hypothetical protein -
  V6C54_RS08775 (V6C54_08785) - 1853334..1853693 (-) 360 WP_047796078.1 HK97-gp10 family putative phage morphogenesis protein -
  V6C54_RS08780 (V6C54_08790) - 1853693..1853995 (-) 303 WP_047796077.1 hypothetical protein -
  V6C54_RS08785 (V6C54_08795) - 1853992..1854321 (-) 330 WP_002436519.1 phage head-tail connector protein -
  V6C54_RS08790 (V6C54_08800) - 1854323..1854592 (-) 270 WP_047796076.1 hypothetical protein -
  V6C54_RS08795 (V6C54_08805) - 1854615..1855529 (-) 915 WP_047796075.1 phage major capsid protein -
  V6C54_RS08800 (V6C54_08810) - 1855545..1856150 (-) 606 WP_047796074.1 DUF4355 domain-containing protein -
  V6C54_RS08805 (V6C54_08815) - 1856404..1856547 (-) 144 WP_169922991.1 hypothetical protein -
  V6C54_RS08810 (V6C54_08820) - 1856540..1857085 (-) 546 WP_047796073.1 hypothetical protein -
  V6C54_RS08815 (V6C54_08825) - 1857105..1858055 (-) 951 WP_047796072.1 minor capsid protein -
  V6C54_RS08820 (V6C54_08830) - 1858062..1859558 (-) 1497 WP_047796071.1 phage portal protein -
  V6C54_RS08825 (V6C54_08835) - 1859572..1860852 (-) 1281 WP_047796070.1 PBSX family phage terminase large subunit -
  V6C54_RS08830 (V6C54_08840) - 1860839..1861276 (-) 438 WP_037579395.1 terminase small subunit -
  V6C54_RS08835 (V6C54_08845) - 1861533..1861949 (-) 417 WP_002436508.1 hypothetical protein -
  V6C54_RS08840 (V6C54_08850) rinB 1862020..1862190 (-) 171 WP_047796069.1 transcriptional activator RinB -
  V6C54_RS08845 (V6C54_08855) - 1862196..1863023 (-) 828 WP_047796068.1 hypothetical protein -
  V6C54_RS08850 (V6C54_08860) - 1863016..1863333 (-) 318 WP_047796067.1 MazG-like family protein -
  V6C54_RS08855 (V6C54_08865) - 1863451..1863801 (-) 351 WP_047796066.1 SA1788 family PVL leukocidin-associated protein -
  V6C54_RS08860 (V6C54_08870) - 1863802..1863990 (-) 189 WP_047796065.1 hypothetical protein -
  V6C54_RS08865 (V6C54_08875) - 1863980..1864390 (-) 411 WP_047796064.1 DUF1064 domain-containing protein -
  V6C54_RS08870 (V6C54_08880) - 1864399..1864644 (-) 246 WP_047796063.1 hypothetical protein -
  V6C54_RS08875 (V6C54_08885) - 1864647..1864802 (-) 156 WP_047796062.1 hypothetical protein -
  V6C54_RS08880 (V6C54_08890) - 1864796..1865557 (-) 762 WP_369952416.1 ATP-binding protein -
  V6C54_RS08885 (V6C54_08895) - 1865577..1866362 (-) 786 WP_047796060.1 conserved phage C-terminal domain-containing protein -
  V6C54_RS08890 (V6C54_08900) - 1866368..1866655 (-) 288 WP_047796059.1 winged helix-turn-helix transcriptional regulator -
  V6C54_RS08895 (V6C54_08905) - 1866652..1867326 (-) 675 WP_047796058.1 putative HNHc nuclease -
  V6C54_RS08900 (V6C54_08910) - 1867340..1867756 (-) 417 WP_047796057.1 single-stranded DNA-binding protein -
  V6C54_RS08905 (V6C54_08915) - 1867749..1868375 (-) 627 WP_047796056.1 DUF1071 domain-containing protein -
  V6C54_RS08910 (V6C54_08920) - 1868368..1868589 (-) 222 WP_047796055.1 DUF2483 family protein -
  V6C54_RS08915 (V6C54_08925) - 1868555..1868837 (-) 283 Protein_1721 chordopoxvirus fusion protein -
  V6C54_RS08920 (V6C54_08930) - 1868859..1869077 (-) 219 WP_047796053.1 hypothetical protein -
  V6C54_RS08925 (V6C54_08935) - 1869169..1869468 (+) 300 WP_002436480.1 hypothetical protein -
  V6C54_RS08930 (V6C54_08940) - 1869552..1869764 (-) 213 WP_002436465.1 DUF771 domain-containing protein -
  V6C54_RS08935 (V6C54_08945) - 1869768..1869935 (-) 168 WP_169922990.1 hypothetical protein -
  V6C54_RS08940 (V6C54_08950) - 1870022..1870261 (-) 240 WP_047796052.1 MW1434 family type I TA system toxin -
  V6C54_RS08945 (V6C54_08955) - 1870350..1870556 (+) 207 WP_047796051.1 hypothetical protein -
  V6C54_RS08950 (V6C54_08960) - 1870542..1870691 (-) 150 WP_169922989.1 hypothetical protein -
  V6C54_RS08955 (V6C54_08965) - 1870755..1871525 (-) 771 WP_053035555.1 DUF6551 family protein -
  V6C54_RS08960 (V6C54_08970) - 1871522..1872481 (-) 960 WP_047796050.1 ParB N-terminal domain-containing protein -
  V6C54_RS08965 (V6C54_08975) - 1872497..1872739 (-) 243 WP_047796049.1 helix-turn-helix transcriptional regulator -
  V6C54_RS08970 (V6C54_08980) - 1872916..1873248 (+) 333 WP_047796048.1 helix-turn-helix domain-containing protein -
  V6C54_RS08975 (V6C54_08985) - 1873263..1873727 (+) 465 WP_047796047.1 ImmA/IrrE family metallo-endopeptidase -
  V6C54_RS08980 (V6C54_08990) - 1873750..1875654 (+) 1905 WP_047796046.1 class I SAM-dependent DNA methyltransferase -
  V6C54_RS08985 (V6C54_08995) - 1875638..1876642 (+) 1005 WP_047796045.1 restriction endonuclease subunit S -
  V6C54_RS08990 (V6C54_09000) - 1876697..1877758 (+) 1062 WP_053035554.1 tyrosine-type recombinase/integrase -
  V6C54_RS09005 (V6C54_09015) comK/comK1 1878265..1878840 (-) 576 WP_002433165.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22695.79 Da        Isoelectric Point: 9.5768

>NTDB_id=937700 V6C54_RS09005 WP_002433165.1 1878265..1878840(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1516943]
MTNFSESIYVIRKGDMLIRPRYDEYQQTSGAEIIRFDKSRKESPFKVQRIIERSCKFYGNSYLSKKSETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQDENIWINMHYIDSIKELKNRKSKVIFANGESFILNVSYHSLWHQYTNAIIYYYMVDKHARM
KSNNPEQPIDYNQSSLNIFEALSRYSLLDDK

Nucleotide


Download         Length: 576 bp        

>NTDB_id=937700 V6C54_RS09005 WP_002433165.1 1878265..1878840(-) (comK/comK1) [Staphylococcus capitis subsp. urealyticus strain Sc1516943]
ATGACTAATTTTAGTGAATCAATCTATGTTATTAGAAAAGGTGACATGTTAATTCGACCAAGGTATGATGAATATCAGCA
AACTTCAGGTGCAGAAATTATAAGATTTGATAAATCACGAAAGGAGAGTCCATTTAAAGTTCAAAGAATTATCGAGAGGT
CCTGCAAATTCTATGGTAATAGCTACCTAAGTAAAAAATCTGAAACTAATAGAATTACAGGTATCTCTAGTAAACCACCT
ATTTTACTTACCCCTTTATTTCCAACTTATTTTTTCCCAACACATTCTGATCGACAAGACGAAAACATCTGGATAAACAT
GCATTATATCGACAGCATCAAAGAACTTAAAAATCGTAAAAGTAAAGTGATATTTGCTAATGGTGAATCATTTATATTAA
ACGTTTCATATCATAGCTTATGGCATCAATATACAAATGCGATTATTTATTATTATATGGTAGATAAACATGCACGTATG
AAATCAAATAATCCAGAACAACCCATTGATTATAATCAATCATCGTTAAATATATTTGAAGCTCTCTCAAGGTATTCTCT
TTTAGATGATAAGTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(8-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.596

98.429

0.754
  comK/comK1 Staphylococcus aureus N315

76.596

98.429

0.754