Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   LLL8_RS11085 Genome accession   NZ_AP025700
Coordinates   2245407..2245691 (-) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis strain L8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2240407..2250691
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLL8_RS11055 (LLL8_21660) - 2240847..2241224 (-) 378 WP_033900715.1 pyridoxamine 5'-phosphate oxidase family protein -
  LLL8_RS11060 (LLL8_21670) - 2241429..2242295 (+) 867 WP_251899925.1 RluA family pseudouridine synthase -
  LLL8_RS11065 (LLL8_21680) - 2242333..2243142 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLL8_RS11070 (LLL8_21690) - 2243135..2243872 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LLL8_RS11075 (LLL8_21700) - 2244049..2244891 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LLL8_RS11080 (LLL8_21710) - 2244888..2245325 (-) 438 WP_201248645.1 zinc-dependent MarR family transcriptional regulator -
  LLL8_RS11085 (LLL8_21720) comGG 2245407..2245691 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLL8_RS11090 (LLL8_21730) comGF 2245730..2246176 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLL8_RS11095 (LLL8_21740) comGE 2246139..2246435 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLL8_RS11100 (LLL8_21750) comGD 2246407..2246823 (-) 417 WP_032941843.1 competence type IV pilus minor pilin ComGD Machinery gene
  LLL8_RS11105 (LLL8_21760) comGC 2246798..2247067 (-) 270 WP_021721869.1 competence type IV pilus major pilin ComGC Machinery gene
  LLL8_RS11110 (LLL8_21770) - 2247121..2248368 (-) 1248 WP_251899926.1 Fic family protein -
  LLL8_RS11120 (LLL8_21780) - 2249061..2249840 (-) 780 WP_350028262.1 peptidoglycan amidohydrolase family protein -
  LLL8_RS11125 (LLL8_21790) - 2249840..2250127 (-) 288 WP_251899928.1 phage holin -
  LLL8_RS11130 (LLL8_21800) - 2250140..2250367 (-) 228 WP_251899929.1 hemolysin XhlA family protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=93709 LLL8_RS11085 WP_025017139.1 2245407..2245691(-) (comGG) [Lactococcus lactis strain L8]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=93709 LLL8_RS11085 WP_025017139.1 2245407..2245691(-) (comGG) [Lactococcus lactis strain L8]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585


Multiple sequence alignment