Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   V5G10_RS02355 Genome accession   NZ_CP145086
Coordinates   450747..451220 (+) Length   157 a.a.
NCBI ID   WP_192941126.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain WHO_C_2024     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 451290..502109 450747..451220 flank 70


Gene organization within MGE regions


Location: 450747..502109
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5G10_RS02355 (V5G10_02355) pilL 450747..451220 (+) 474 WP_192941126.1 PilX family type IV pilin Machinery gene
  V5G10_RS02360 (V5G10_02360) - 451290..451598 (-) 309 WP_050170999.1 AzlD family protein -
  V5G10_RS02365 (V5G10_02365) - 451595..452303 (-) 709 Protein_461 AzlC family ABC transporter permease -
  V5G10_RS02370 (V5G10_02370) dut 452469..452921 (+) 453 WP_003702446.1 dUTP diphosphatase -
  V5G10_RS02375 (V5G10_02375) dapC 452999..454186 (+) 1188 WP_082277589.1 succinyldiaminopimelate transaminase -
  V5G10_RS02380 (V5G10_02380) yaaA 454342..455121 (+) 780 WP_003692836.1 peroxide stress protein YaaA -
  V5G10_RS02395 (V5G10_02395) - 455651..456844 (+) 1194 WP_017146746.1 integrase arm-type DNA-binding domain-containing protein -
  V5G10_RS02400 (V5G10_02400) - 457200..457469 (-) 270 WP_003687928.1 hypothetical protein -
  V5G10_RS02405 (V5G10_02405) - 457664..458347 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  V5G10_RS02410 (V5G10_02410) - 458661..458894 (-) 234 Protein_468 hypothetical protein -
  V5G10_RS02415 (V5G10_02415) - 459005..459220 (-) 216 WP_003691538.1 hypothetical protein -
  V5G10_RS02420 (V5G10_02420) - 459272..459763 (-) 492 WP_353425252.1 siphovirus Gp157 family protein -
  V5G10_RS02425 (V5G10_02425) - 459760..459942 (-) 183 WP_003691535.1 hypothetical protein -
  V5G10_RS02430 (V5G10_02430) - 460082..460768 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  V5G10_RS02435 (V5G10_02435) - 460837..460998 (-) 162 WP_003693867.1 hypothetical protein -
  V5G10_RS02440 (V5G10_02440) - 460995..461270 (-) 276 WP_003694990.1 NGO1622 family putative holin -
  V5G10_RS02445 (V5G10_02445) - 461423..461755 (-) 333 WP_003694992.1 hypothetical protein -
  V5G10_RS02450 (V5G10_02450) - 461896..462096 (-) 201 WP_003695499.1 hypothetical protein -
  V5G10_RS02455 (V5G10_02455) - 462579..462797 (+) 219 WP_003691731.1 hypothetical protein -
  V5G10_RS02460 (V5G10_02460) - 462813..463172 (-) 360 WP_003691733.1 hypothetical protein -
  V5G10_RS02465 (V5G10_02465) - 463173..463712 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  V5G10_RS02470 (V5G10_02470) - 463872..464576 (-) 705 WP_047950481.1 helix-turn-helix transcriptional regulator -
  V5G10_RS02475 (V5G10_02475) - 464704..464919 (+) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  V5G10_RS02480 (V5G10_02480) - 464999..465154 (+) 156 WP_003698902.1 hypothetical protein -
  V5G10_RS02485 (V5G10_02485) - 465131..465319 (-) 189 WP_003706568.1 hypothetical protein -
  V5G10_RS02490 (V5G10_02490) - 465493..465720 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  V5G10_RS02495 (V5G10_02495) - 466399..466902 (+) 504 WP_010360005.1 hypothetical protein -
  V5G10_RS02500 (V5G10_02500) - 466899..468260 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  V5G10_RS02505 (V5G10_02505) - 468297..468560 (+) 264 WP_154230797.1 hypothetical protein -
  V5G10_RS02510 (V5G10_02510) - 468599..469093 (+) 495 WP_003693463.1 DUF3310 domain-containing protein -
  V5G10_RS02515 (V5G10_02515) - 469455..469604 (+) 150 WP_003692854.1 hypothetical protein -
  V5G10_RS02520 (V5G10_02520) - 469632..469913 (+) 282 WP_003689109.1 hypothetical protein -
  V5G10_RS02525 (V5G10_02525) - 469904..470284 (+) 381 WP_033911195.1 RusA family crossover junction endodeoxyribonuclease -
  V5G10_RS02530 (V5G10_02530) - 470551..470958 (+) 408 WP_003691430.1 hypothetical protein -
  V5G10_RS02535 (V5G10_02535) - 471181..471699 (+) 519 WP_003701452.1 hypothetical protein -
  V5G10_RS02540 (V5G10_02540) - 472020..472847 (+) 828 WP_003706022.1 KilA-N domain-containing protein -
  V5G10_RS02545 (V5G10_02545) - 473140..473589 (+) 450 WP_003689093.1 hypothetical protein -
  V5G10_RS02550 (V5G10_02550) terL 473651..475072 (+) 1422 WP_003689090.1 phage terminase large subunit -
  V5G10_RS02555 (V5G10_02555) - 475069..477216 (+) 2148 WP_003691423.1 phage portal protein -
  V5G10_RS02560 (V5G10_02560) - 477284..478441 (+) 1158 WP_003691421.1 HK97 family phage prohead protease -
  V5G10_RS02565 (V5G10_02565) - 478482..479981 (+) 1500 WP_003689084.1 hypothetical protein -
  V5G10_RS02570 (V5G10_02570) - 479988..480356 (+) 369 WP_050171438.1 hypothetical protein -
  V5G10_RS02575 (V5G10_02575) - 480359..480889 (+) 531 WP_003689080.1 head-tail connector protein -
  V5G10_RS02580 (V5G10_02580) - 480889..481371 (+) 483 WP_010357634.1 HK97 gp10 family phage protein -
  V5G10_RS02585 (V5G10_02585) - 481368..481796 (+) 429 WP_003689076.1 hypothetical protein -
  V5G10_RS02590 (V5G10_02590) - 481822..482595 (+) 774 WP_003691416.1 hypothetical protein -
  V5G10_RS02595 (V5G10_02595) - 482656..482985 (+) 330 WP_003692871.1 hypothetical protein -
  V5G10_RS02600 (V5G10_02600) - 482997..483263 (+) 267 WP_010357639.1 hypothetical protein -
  V5G10_RS02605 (V5G10_02605) - 483263..483862 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  V5G10_RS02610 (V5G10_02610) - 483859..484713 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  V5G10_RS02615 (V5G10_02615) - 484715..485146 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  V5G10_RS02620 (V5G10_02620) - 485174..485452 (-) 279 WP_003689062.1 helix-turn-helix domain-containing protein -
  V5G10_RS02625 (V5G10_02625) - 485692..489837 (+) 4146 WP_353425393.1 phage tail protein -
  V5G10_RS02630 (V5G10_02630) - 489949..490254 (+) 306 WP_047920301.1 hypothetical protein -
  V5G10_RS02635 (V5G10_02635) - 490325..490795 (+) 471 WP_003689057.1 hypothetical protein -
  V5G10_RS02640 (V5G10_02640) - 490796..491128 (+) 333 WP_003691408.1 hypothetical protein -
  V5G10_RS02645 (V5G10_02645) - 491496..491843 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  V5G10_RS02650 (V5G10_02650) - 491843..492079 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  V5G10_RS02655 (V5G10_02655) - 492286..492825 (+) 540 WP_003703868.1 TIGR02594 family protein -
  V5G10_RS02660 (V5G10_02660) - 492826..493170 (+) 345 WP_003695464.1 hypothetical protein -
  V5G10_RS02665 (V5G10_02665) - 493639..493788 (+) 150 WP_003691402.1 hypothetical protein -
  V5G10_RS02670 (V5G10_02670) - 493818..496862 (+) 3045 WP_353425397.1 tape measure protein -
  V5G10_RS02675 (V5G10_02675) - 496922..497401 (-) 480 WP_071290059.1 DUF4760 domain-containing protein -
  V5G10_RS02680 (V5G10_02680) - 497743..498732 (-) 990 WP_003689040.1 site-specific integrase -
  V5G10_RS02685 (V5G10_02685) - 498992..499180 (-) 189 WP_003689039.1 hypothetical protein -
  V5G10_RS02690 (V5G10_02690) purM 499421..500455 (+) 1035 WP_003692893.1 phosphoribosylformylglycinamidine cyclo-ligase -
  V5G10_RS02695 (V5G10_02695) - 501073..501378 (+) 306 WP_082294427.1 hypothetical protein -
  V5G10_RS02700 (V5G10_02700) - 501456..502109 (+) 654 WP_353425209.1 IS1595 family transposase -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17510.28 Da        Isoelectric Point: 9.5690

>NTDB_id=937083 V5G10_RS02355 WP_192941126.1 450747..451220(+) (pilL) [Neisseria gonorrhoeae strain WHO_C_2024]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVSGYKM
NPKIAKKYSVSVHFVNKEKPRAYKLVGVPNAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=937083 V5G10_RS02355 WP_192941126.1 450747..451220(+) (pilL) [Neisseria gonorrhoeae strain WHO_C_2024]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGCATTTTGTCAATAAGGAAAAACCAAGGGCATACAAGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

94.904

100

0.949
  pilX Neisseria meningitidis 8013

87.898

100

0.879