Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   V5F91_RS02325 Genome accession   NZ_CP145064
Coordinates   452451..452924 (+) Length   157 a.a.
NCBI ID   WP_012503482.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain WHO_S_2024     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 452994..508667 452451..452924 flank 70


Gene organization within MGE regions


Location: 452451..508667
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5F91_RS02325 (V5F91_02330) pilL 452451..452924 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  V5F91_RS02330 (V5F91_02335) - 452994..453302 (-) 309 WP_010359926.1 AzlD family protein -
  V5F91_RS02335 (V5F91_02340) - 453299..454009 (-) 711 Protein_455 AzlC family ABC transporter permease -
  V5F91_RS02340 (V5F91_02345) dut 454175..454627 (+) 453 WP_003687923.1 dUTP diphosphatase -
  V5F91_RS02345 (V5F91_02350) dapC 454699..455886 (+) 1188 WP_071197481.1 succinyldiaminopimelate transaminase -
  V5F91_RS02350 (V5F91_02355) yaaA 456042..456821 (+) 780 WP_003692836.1 peroxide stress protein YaaA -
  V5F91_RS02365 (V5F91_02370) - 457351..458544 (+) 1194 WP_017146746.1 integrase arm-type DNA-binding domain-containing protein -
  V5F91_RS02370 (V5F91_02375) - 458900..459169 (-) 270 WP_003687928.1 hypothetical protein -
  V5F91_RS02375 (V5F91_02380) - 459364..460047 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  V5F91_RS02380 (V5F91_02385) - 460361..460594 (-) 234 Protein_462 hypothetical protein -
  V5F91_RS02385 (V5F91_02390) - 460705..460920 (-) 216 WP_003691538.1 hypothetical protein -
  V5F91_RS02390 (V5F91_02395) - 460972..461463 (-) 492 WP_033910329.1 siphovirus Gp157 family protein -
  V5F91_RS02395 (V5F91_02400) - 461460..461642 (-) 183 WP_003691535.1 hypothetical protein -
  V5F91_RS02400 (V5F91_02405) - 461782..462468 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  V5F91_RS02405 (V5F91_02410) - 462537..462698 (-) 162 WP_003702497.1 hypothetical protein -
  V5F91_RS02410 (V5F91_02415) - 462695..462970 (-) 276 WP_003695501.1 NGO1622 family putative holin -
  V5F91_RS02415 (V5F91_02420) - 463123..463455 (-) 333 WP_033910331.1 phage associated protein -
  V5F91_RS02420 (V5F91_02425) - 464069..464287 (+) 219 WP_003691731.1 hypothetical protein -
  V5F91_RS02425 (V5F91_02430) - 464304..464663 (-) 360 WP_003694117.1 hypothetical protein -
  V5F91_RS02430 (V5F91_02435) - 464664..465203 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  V5F91_RS02435 (V5F91_02440) - 465363..466067 (-) 705 WP_353174382.1 helix-turn-helix transcriptional regulator -
  V5F91_RS02440 (V5F91_02445) - 466195..466410 (+) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  V5F91_RS02445 (V5F91_02450) - 466490..466645 (+) 156 WP_003689578.1 hypothetical protein -
  V5F91_RS02450 (V5F91_02455) - 466622..466810 (-) 189 WP_003691445.1 hypothetical protein -
  V5F91_RS02455 (V5F91_02460) - 466983..467210 (+) 228 WP_003705596.1 helix-turn-helix domain-containing protein -
  V5F91_RS02460 (V5F91_02465) - 467207..468301 (+) 1095 WP_353174385.1 helix-turn-helix domain-containing protein -
  V5F91_RS02465 (V5F91_02470) - 468313..469092 (+) 780 WP_047917947.1 ATP-binding protein -
  V5F91_RS02470 (V5F91_02475) - 469162..469368 (+) 207 WP_353174388.1 hypothetical protein -
  V5F91_RS02475 (V5F91_02480) - 469407..469901 (+) 495 WP_047923539.1 DUF3310 domain-containing protein -
  V5F91_RS02480 (V5F91_02485) - 470250..470399 (+) 150 WP_003689110.1 hypothetical protein -
  V5F91_RS02485 (V5F91_02490) - 470427..470696 (+) 270 WP_047921130.1 hypothetical protein -
  V5F91_RS02490 (V5F91_02495) - 470687..471067 (+) 381 WP_033911195.1 RusA family crossover junction endodeoxyribonuclease -
  V5F91_RS02495 (V5F91_02500) - 471084..471212 (-) 129 WP_012503747.1 hypothetical protein -
  V5F91_RS02500 (V5F91_02505) - 471334..471741 (+) 408 WP_192370516.1 hypothetical protein -
  V5F91_RS02505 (V5F91_02510) - 471832..472992 (+) 1161 WP_139596015.1 type I restriction endonuclease -
  V5F91_RS02510 (V5F91_02515) - 473274..474143 (+) 870 WP_353174393.1 BRO family protein -
  V5F91_RS02515 (V5F91_02520) - 474436..474885 (+) 450 WP_003689093.1 hypothetical protein -
  V5F91_RS02520 (V5F91_02525) terL 474947..476368 (+) 1422 WP_003689090.1 phage terminase large subunit -
  V5F91_RS02525 (V5F91_02530) - 476365..478512 (+) 2148 WP_050159332.1 phage portal protein -
  V5F91_RS02530 (V5F91_02535) - 478580..479737 (+) 1158 WP_082295718.1 HK97 family phage prohead protease -
  V5F91_RS02535 (V5F91_02540) - 479778..481277 (+) 1500 WP_033910832.1 hypothetical protein -
  V5F91_RS02540 (V5F91_02545) - 481284..481646 (+) 363 WP_003689082.1 hypothetical protein -
  V5F91_RS02545 (V5F91_02550) - 481649..482179 (+) 531 WP_003689080.1 head-tail connector protein -
  V5F91_RS02550 (V5F91_02555) - 482179..482661 (+) 483 WP_071290056.1 HK97 gp10 family phage protein -
  V5F91_RS02555 (V5F91_02560) - 482658..483086 (+) 429 WP_003697213.1 hypothetical protein -
  V5F91_RS02560 (V5F91_02565) - 483112..483885 (+) 774 WP_003691416.1 hypothetical protein -
  V5F91_RS02565 (V5F91_02570) - 483946..484275 (+) 330 WP_003692871.1 hypothetical protein -
  V5F91_RS02570 (V5F91_02575) - 484287..484553 (+) 267 WP_003689070.1 hypothetical protein -
  V5F91_RS02575 (V5F91_02580) - 484553..485152 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  V5F91_RS02580 (V5F91_02585) - 485149..486003 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  V5F91_RS02585 (V5F91_02590) - 486005..486436 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  V5F91_RS02590 (V5F91_02595) - 486464..486742 (-) 279 WP_003689062.1 helix-turn-helix domain-containing protein -
  V5F91_RS02595 (V5F91_02600) - 486982..491127 (+) 4146 WP_353174397.1 phage tail protein -
  V5F91_RS02600 (V5F91_02605) - 491239..491544 (+) 306 WP_047920301.1 hypothetical protein -
  V5F91_RS02605 (V5F91_02610) - 491615..492085 (+) 471 WP_139596019.1 hypothetical protein -
  V5F91_RS02610 (V5F91_02615) - 492086..492418 (+) 333 WP_003691408.1 hypothetical protein -
  V5F91_RS02615 (V5F91_02620) - 492546..492779 (-) 234 WP_003692884.1 hypothetical protein -
  V5F91_RS02620 (V5F91_02625) - 492787..493134 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  V5F91_RS02625 (V5F91_02630) - 493134..493370 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  V5F91_RS02630 (V5F91_02635) - 493410..493535 (+) 126 WP_255294325.1 hypothetical protein -
  V5F91_RS02635 (V5F91_02640) - 493577..494116 (+) 540 WP_033910248.1 TIGR02594 family protein -
  V5F91_RS02640 (V5F91_02645) - 494117..494461 (+) 345 WP_047923378.1 hypothetical protein -
  V5F91_RS02645 (V5F91_02650) - 494445..494618 (+) 174 WP_017146757.1 hypothetical protein -
  V5F91_RS02650 (V5F91_02655) - 494960..495109 (+) 150 WP_003689043.1 hypothetical protein -
  V5F91_RS02655 (V5F91_02660) - 495139..498183 (+) 3045 WP_353174401.1 tape measure protein -
  V5F91_RS02660 (V5F91_02665) - 498243..498722 (-) 480 WP_071290059.1 DUF4760 domain-containing protein -
  V5F91_RS02665 (V5F91_02670) - 499064..500053 (-) 990 WP_003689040.1 site-specific integrase -
  V5F91_RS02670 (V5F91_02675) purM 500742..501776 (+) 1035 WP_003692893.1 phosphoribosylformylglycinamidine cyclo-ligase -
  V5F91_RS02675 (V5F91_02680) - 502774..503426 (+) 653 Protein_521 IS1595 family transposase -
  V5F91_RS02680 (V5F91_02685) - 503560..505581 (+) 2022 WP_353174404.1 BCCT family transporter -
  V5F91_RS02685 (V5F91_02690) - 505670..507223 (-) 1554 WP_033910207.1 fatty acid--CoA ligase -
  V5F91_RS02690 (V5F91_02695) - 507274..507402 (+) 129 WP_255294324.1 hypothetical protein -
  V5F91_RS02695 (V5F91_02700) - 507474..508667 (-) 1194 WP_033910206.1 SGNH/GDSL hydrolase family protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17486.30 Da        Isoelectric Point: 9.9561

>NTDB_id=936748 V5F91_RS02325 WP_012503482.1 452451..452924(+) (pilL) [Neisseria gonorrhoeae strain WHO_S_2024]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=936748 V5F91_RS02325 WP_012503482.1 452451..452924(+) (pilL) [Neisseria gonorrhoeae strain WHO_S_2024]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.72

100

0.917
  pilX Neisseria meningitidis 8013

85.35

100

0.854