Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilK   Type   Machinery gene
Locus tag   V5G16_RS02335 Genome accession   NZ_CP145062
Coordinates   450531..451142 (+) Length   203 a.a.
NCBI ID   WP_071197480.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain WHO_T_2024     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 451687..502328 450531..451142 flank 545


Gene organization within MGE regions


Location: 450531..502328
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5G16_RS02335 (V5G16_02340) pilK 450531..451142 (+) 612 WP_071197480.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  V5G16_RS02340 (V5G16_02345) pilL 451144..451617 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  V5G16_RS02345 (V5G16_02350) - 451687..451995 (-) 309 WP_010359926.1 AzlD family protein -
  V5G16_RS02350 (V5G16_02355) - 451992..452702 (-) 711 Protein_458 AzlC family ABC transporter permease -
  V5G16_RS02355 (V5G16_02360) dut 452868..453320 (+) 453 WP_003687923.1 dUTP diphosphatase -
  V5G16_RS02360 (V5G16_02365) dapC 453392..454579 (+) 1188 WP_071197481.1 succinyldiaminopimelate transaminase -
  V5G16_RS02365 (V5G16_02370) yaaA 454735..455514 (+) 780 WP_003692836.1 peroxide stress protein YaaA -
  V5G16_RS02380 (V5G16_02385) - 456044..457237 (+) 1194 WP_017146746.1 integrase arm-type DNA-binding domain-containing protein -
  V5G16_RS02385 (V5G16_02390) - 457593..457862 (-) 270 WP_003687928.1 hypothetical protein -
  V5G16_RS02390 (V5G16_02395) - 458057..458740 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  V5G16_RS02395 (V5G16_02400) - 459054..459287 (-) 234 Protein_465 hypothetical protein -
  V5G16_RS02400 (V5G16_02405) - 459398..459613 (-) 216 WP_082285068.1 hypothetical protein -
  V5G16_RS02405 (V5G16_02410) - 459665..460156 (-) 492 WP_123776199.1 siphovirus Gp157 family protein -
  V5G16_RS02410 (V5G16_02415) - 460153..460335 (-) 183 WP_003691535.1 hypothetical protein -
  V5G16_RS02415 (V5G16_02420) - 460476..461162 (-) 687 WP_033910330.1 phage replication initiation protein, NGO0469 family -
  V5G16_RS02420 (V5G16_02425) - 461231..461392 (-) 162 WP_004464809.1 hypothetical protein -
  V5G16_RS02425 (V5G16_02430) - 461389..461664 (-) 276 WP_010359972.1 NGO1622 family putative holin -
  V5G16_RS02430 (V5G16_02435) - 461817..462149 (-) 333 WP_050154664.1 hypothetical protein -
  V5G16_RS02435 (V5G16_02440) - 462291..462566 (-) 276 WP_050302440.1 hypothetical protein -
  V5G16_RS02440 (V5G16_02445) - 462563..463039 (-) 477 WP_003691526.1 hypothetical protein -
  V5G16_RS02445 (V5G16_02450) - 463072..463272 (-) 201 WP_047920246.1 hypothetical protein -
  V5G16_RS02450 (V5G16_02455) - 463756..463974 (+) 219 WP_003691731.1 hypothetical protein -
  V5G16_RS02455 (V5G16_02460) - 463991..464350 (-) 360 WP_003691733.1 hypothetical protein -
  V5G16_RS02460 (V5G16_02465) - 464351..464890 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  V5G16_RS02465 (V5G16_02470) - 465050..465766 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  V5G16_RS02470 (V5G16_02475) - 466147..466374 (+) 228 WP_047949281.1 helix-turn-helix domain-containing protein -
  V5G16_RS02475 (V5G16_02480) - 466371..467382 (+) 1012 Protein_481 helix-turn-helix domain-containing protein -
  V5G16_RS02480 (V5G16_02485) - 467398..468180 (+) 783 WP_025456432.1 ATP-binding protein -
  V5G16_RS02485 (V5G16_02490) - 468250..468456 (+) 207 WP_154251217.1 hypothetical protein -
  V5G16_RS02490 (V5G16_02495) - 468495..468989 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  V5G16_RS02495 (V5G16_02500) - 469166..469315 (+) 150 WP_003692854.1 hypothetical protein -
  V5G16_RS02500 (V5G16_02505) - 469344..469625 (+) 282 WP_003689109.1 hypothetical protein -
  V5G16_RS02505 (V5G16_02510) - 469616..469996 (+) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  V5G16_RS02510 (V5G16_02515) - 470013..470141 (-) 129 WP_256263200.1 hypothetical protein -
  V5G16_RS02515 (V5G16_02520) - 470263..470670 (+) 408 WP_003691430.1 hypothetical protein -
  V5G16_RS02520 (V5G16_02525) - 470761..471921 (+) 1161 WP_003691428.1 type I restriction endonuclease -
  V5G16_RS02525 (V5G16_02530) - 472203..473072 (+) 870 WP_050155707.1 BRO family protein -
  V5G16_RS02530 (V5G16_02535) - 473365..473814 (+) 450 WP_003695485.1 hypothetical protein -
  V5G16_RS02535 (V5G16_02540) terL 473876..475297 (+) 1422 WP_003689090.1 phage terminase large subunit -
  V5G16_RS02540 (V5G16_02545) - 475294..477441 (+) 2148 WP_003691423.1 phage portal protein -
  V5G16_RS02545 (V5G16_02550) - 477509..478666 (+) 1158 WP_010360058.1 HK97 family phage prohead protease -
  V5G16_RS02550 (V5G16_02555) - 478707..480206 (+) 1500 WP_003689084.1 hypothetical protein -
  V5G16_RS02555 (V5G16_02560) - 480213..480575 (+) 363 WP_003689082.1 hypothetical protein -
  V5G16_RS02560 (V5G16_02565) - 480578..481108 (+) 531 WP_003689080.1 head-tail connector protein -
  V5G16_RS02565 (V5G16_02570) - 481108..481590 (+) 483 WP_003703855.1 HK97 gp10 family phage protein -
  V5G16_RS02570 (V5G16_02575) - 481587..482015 (+) 429 WP_003689076.1 hypothetical protein -
  V5G16_RS02575 (V5G16_02580) - 482041..482814 (+) 774 WP_003691416.1 hypothetical protein -
  V5G16_RS02580 (V5G16_02585) - 482875..483204 (+) 330 WP_003689072.1 hypothetical protein -
  V5G16_RS02585 (V5G16_02590) - 483216..483482 (+) 267 WP_003689070.1 hypothetical protein -
  V5G16_RS02590 (V5G16_02595) - 483482..484081 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  V5G16_RS02595 (V5G16_02600) - 484078..484932 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  V5G16_RS02600 (V5G16_02605) - 484934..485365 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  V5G16_RS02605 (V5G16_02610) - 485393..485671 (-) 279 WP_003692877.1 helix-turn-helix domain-containing protein -
  V5G16_RS02610 (V5G16_02615) - 485911..490056 (+) 4146 WP_050303815.1 phage tail protein -
  V5G16_RS02615 (V5G16_02620) - 490168..490473 (+) 306 WP_003689058.1 hypothetical protein -
  V5G16_RS02620 (V5G16_02625) - 490544..491014 (+) 471 WP_003689057.1 hypothetical protein -
  V5G16_RS02625 (V5G16_02630) - 491015..491347 (+) 333 WP_003691408.1 hypothetical protein -
  V5G16_RS02630 (V5G16_02635) - 491715..492062 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  V5G16_RS02635 (V5G16_02640) - 492062..492298 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  V5G16_RS02640 (V5G16_02645) - 492338..492463 (+) 126 WP_255294325.1 hypothetical protein -
  V5G16_RS02645 (V5G16_02650) - 492505..493044 (+) 540 WP_050165526.1 TIGR02594 family protein -
  V5G16_RS02650 (V5G16_02655) - 493045..493389 (+) 345 WP_003695464.1 hypothetical protein -
  V5G16_RS02655 (V5G16_02660) - 493373..493546 (+) 174 WP_017146757.1 hypothetical protein -
  V5G16_RS02660 (V5G16_02665) - 493858..494007 (+) 150 WP_003691402.1 hypothetical protein -
  V5G16_RS02665 (V5G16_02670) - 494037..497081 (+) 3045 WP_050154369.1 tape measure protein -
  V5G16_RS02670 (V5G16_02675) - 497141..497620 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  V5G16_RS02675 (V5G16_02680) - 497962..498951 (-) 990 WP_003689040.1 site-specific integrase -
  V5G16_RS02680 (V5G16_02685) - 499211..499399 (-) 189 WP_003689039.1 hypothetical protein -
  V5G16_RS02685 (V5G16_02690) purM 499640..500674 (+) 1035 WP_003689038.1 phosphoribosylformylglycinamidine cyclo-ligase -
  V5G16_RS02690 (V5G16_02695) - 501292..501597 (+) 306 WP_082294427.1 hypothetical protein -
  V5G16_RS02695 (V5G16_02700) - 501675..502328 (+) 654 WP_353105766.1 IS1595 family transposase -

Sequence

Protein


Download         Length: 203 a.a.        Molecular weight: 22082.06 Da        Isoelectric Point: 8.4486

>NTDB_id=936701 V5G16_RS02335 WP_071197480.1 450531..451142(+) (pilK) [Neisseria gonorrhoeae strain WHO_T_2024]
MRKQNTLTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNDNGNEEAFGNIVVKGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 612 bp        

>NTDB_id=936701 V5G16_RS02335 WP_071197480.1 450531..451142(+) (pilK) [Neisseria gonorrhoeae strain WHO_T_2024]
ATGCGCAAACAGAACACTTTGACGGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
TATGATAGTCGTGGCTTTTTTGGTTGTAACTGCCGCGCAGTCTTACAATACCGAGCAGCGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATGATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGAAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGCCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA

Domains

Predicted by InterproScan.

PilX N-terminal (PilX_N)

(17-67)

Type IV pilus assembly protein PilX C-term (PilX)

(92-198)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

95.074

100

0.951